Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of EFNA3 transfected lysate using anti-EFNA3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EFNA3 MaxPab rabbit polyclonal antibody.)

Mouse EFNA3 Monoclonal Antibody | anti-EFNA3 antibody

EFNA3 (ephrin-A3, EFL2, EPLG3, Ehk1-L, LERK3) (HRP)

Gene Names
EFNA3; EFL2; EPLG3; LERK3; Ehk1-L
Applications
ELISA, Immunoprecipitation
Purity
Purified
Synonyms
EFNA3; Monoclonal Antibody; EFNA3 (ephrin-A3; EFL2; EPLG3; Ehk1-L; LERK3) (HRP); ephrin-A3; LERK3; anti-EFNA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H3
Specificity
Recognizes EFNA3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-EFNA3 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EFNA3 (NP_004943, 45aa-145aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of EFNA3 transfected lysate using anti-EFNA3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EFNA3 MaxPab rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of EFNA3 transfected lysate using anti-EFNA3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EFNA3 MaxPab rabbit polyclonal antibody.)
Product Categories/Family for anti-EFNA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.7kDa (434aa)
NCBI Official Full Name
ephrin-A3
NCBI Official Synonym Full Names
ephrin A3
NCBI Official Symbol
EFNA3
NCBI Official Synonym Symbols
EFL2; EPLG3; LERK3; Ehk1-L
NCBI Protein Information
ephrin-A3
UniProt Protein Name
Ephrin-A3
Protein Family
UniProt Gene Name
EFNA3
UniProt Synonym Gene Names
EFL2; EPLG3; LERK3; EHK1-L; LERK-3
UniProt Entry Name
EFNA3_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA3: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Belongs to the ephrin family.

Protein type: Ligand, receptor tyrosine kinase; Membrane protein, GPI anchor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: ephrin receptor binding; transmembrane-ephrin receptor activity

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway

Research Articles on EFNA3

Similar Products

Product Notes

The EFNA3 efna3 (Catalog #AAA6182376) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EFNA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EFNA3 efna3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EFNA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.