Mouse EFNA3 Monoclonal Antibody | anti-EFNA3 antibody

EFNA3 (ephrin-A3, EFL2, EPLG3, Ehk1-L, LERK3) (Biotin)

Cat. Num. AAA6173556

• Gene Names: EFNA3; EFL2; EPLG3; LERK3; Ehk1-L
• Applications: ELISA, Immunoprecipitation
• Purity: Purified
• Synonyms: EFNA3; Monoclonal Antibody; EFNA3 (ephrin-A3; EFL2; EPLG3; Ehk1-L; LERK3) (Biotin); ephrin-A3; LERK3; anti-EFNA3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H3
• Specificity: Recognizes EFNA3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-EFNA3 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: EFNA3 (NP_004943, 45aa-145aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of EFNA3 transfected lysate using anti-EFNA3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with EFNA3 MaxPab rabbit polyclonal antibody.)

Related Product Information for anti-EFNA3 antibody

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq]

Product Categories/Family for anti-EFNA3 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4826708
• NCBI GeneID: 1944
• NCBI Accession #: NP_004943
• NCBI GenBank Nucleotide #: NP_004943.1
• UniProt Accession #: P52797
• Molecular Weight: 48.7kDa (434aa)
• NCBI Official Full Name: ephrin-A3
• NCBI Official Synonym Full Names: ephrin A3
• NCBI Official Symbol: EFNA3
• NCBI Official Synonym Symbols: EFL2; EPLG3; LERK3; Ehk1-L
• NCBI Protein Information: ephrin-A3
• UniProt Protein Name: Ephrin-A3
• Protein Family: Ephrin
• UniProt Gene Name: EFNA3
• UniProt Synonym Gene Names: EFL2; EPLG3; LERK3; EHK1-L; LERK-3
• UniProt Entry Name: EFNA3_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA3: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Belongs to the ephrin family.

Protein type: Ligand, receptor tyrosine kinase; Membrane protein, GPI anchor; Cell development/differentiation

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: ephrin receptor binding; transmembrane-ephrin receptor activity

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway