Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10.Lane 1: EFHD1 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.)

Mouse EFHD1 Monoclonal Antibody | anti-EFHD1 antibody

EFHD1 (EF-hand Domain Family, Member D1, DKFZp781H0842, FLJ13612, MST133, MSTP133, PP3051) (APC)

Gene Names
EFHD1; SWS2; MST133; PP3051; MSTP133; FLJ13612; DKFZp781H0842
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
EFHD1; Monoclonal Antibody; EFHD1 (EF-hand Domain Family; Member D1; DKFZp781H0842; FLJ13612; MST133; MSTP133; PP3051) (APC); EF-hand Domain Family; PP3051; anti-EFHD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Specificity
Recognizes EFHD1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EFHD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EFHD1 (NP_079478.1, 168aa-238aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10.Lane 1: EFHD1 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EFHD1 expression in transfected 293T cell line by EFHD1 monoclonal antibody (M11), clone 3D10.Lane 1: EFHD1 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-EFHD1 antibody
EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]). [supplied by OMIM]
Product Categories/Family for anti-EFHD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,928 Da
NCBI Official Full Name
EF-hand domain-containing protein D1
NCBI Official Synonym Full Names
EF-hand domain family, member D1
NCBI Official Symbol
EFHD1
NCBI Official Synonym Symbols
SWS2; MST133; PP3051; MSTP133; FLJ13612; DKFZp781H0842
NCBI Protein Information
EF-hand domain-containing protein D1; swiprosin-2; OTTHUMP00000164362; OTTHUMP00000203630; OTTHUMP00000203631; OTTHUMP00000203632; EF hand domain containing 1; EF hand domain family, member D1; EF-hand domain-containing protein 1
UniProt Protein Name
EF-hand domain-containing protein D1
UniProt Gene Name
EFHD1
UniProt Synonym Gene Names
SWS2
UniProt Entry Name
EFHD1_HUMAN

Uniprot Description

EFHD1: 2 isoforms of the human protein are produced by alternative splicing

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: mitochondrial inner membrane

Molecular Function: calcium ion binding

Biological Process: neurite development

Similar Products

Product Notes

The EFHD1 efhd1 (Catalog #AAA6169034) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EFHD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EFHD1 efhd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EFHD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.