Mouse anti-Human EDG3 Monoclonal Antibody | anti-EDG3 antibody

EDG3 (Sphingosine 1-phosphate Receptor 3, S1P Receptor 3, S1P3, Endothelial Differentiation G-protein Coupled Receptor 3, Sphingosine 1-phosphate Receptor Edg-3, S1P Receptor Edg-3, S1PR3) (MaxLight 650)

Cat. Num. AAA6221945

• Gene Names: S1PR3; EDG3; LPB3; S1P3; EDG-3
• Reactivity: Human
• Applications: Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EDG3; Monoclonal Antibody; EDG3 (Sphingosine 1-phosphate Receptor 3; S1P Receptor 3; S1P3; Endothelial Differentiation G-protein Coupled Receptor 3; Sphingosine 1-phosphate Receptor Edg-3; S1P Receptor Edg-3; S1PR3) (MaxLight 650); anti-EDG3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G11
• Specificity: Recognizes human EDG3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

• Applicable Applications for anti-EDG3 antibody: FLISA, Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa302-378 from human EDG3 (NP_005217.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Product Categories/Family for anti-EDG3 antibody

Antibodies; G Protein Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 38788193
• NCBI GeneID: 1903
• NCBI Accession #: NP_005217.2
• NCBI GenBank Nucleotide #: NM_005226
• UniProt Accession #: Q99500; Q5SQD8; Q7Z5I2
• Molecular Weight: 42,250 Da
• NCBI Official Full Name: sphingosine 1-phosphate receptor 3
• NCBI Official Synonym Full Names: sphingosine-1-phosphate receptor 3
• NCBI Official Symbol: S1PR3
• NCBI Official Synonym Symbols: EDG3; LPB3; S1P3; EDG-3
• NCBI Protein Information: sphingosine 1-phosphate receptor 3; S1P receptor 3; S1P receptor EDG3; S1P receptor Edg-3; sphingosine 1-phosphate receptor Edg-3; endothelial differentiation G-protein coupled receptor 3; G protein-coupled receptor, endothelial differentiation gene-3; en
• UniProt Protein Name: Sphingosine 1-phosphate receptor 3
• UniProt Gene Name: S1PR3
• UniProt Synonym Gene Names: EDG3; S1P receptor 3; S1P3
• UniProt Entry Name: S1PR3_HUMAN

NCBI Description

This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq, Jul 2008]

Uniprot Description

S1PR3: Receptor for the lysosphingolipid sphingosine 1- phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 9q22.1-q22.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; integrin binding; lipid binding

Biological Process: G-protein coupled receptor protein signaling pathway; anatomical structure morphogenesis; elevation of cytosolic calcium ion concentration; regulation of interleukin-1 beta production; positive regulation of cell proliferation; cytokine production; G-protein signaling, adenylate cyclase inhibiting pathway; inflammatory response