Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to EDC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Mouse anti-Human EDC4 Monoclonal Antibody | anti-EDC4 antibody

EDC4 (Enhancer of mRNA-decapping Protein 4, Autoantigen Ge-1, Autoantigen RCD-8, Human Enhancer of Decapping Large Subunit, Hedls, HEDLS) (HRP)

Gene Names
EDC4; GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EDC4; Monoclonal Antibody; EDC4 (Enhancer of mRNA-decapping Protein 4; Autoantigen Ge-1; Autoantigen RCD-8; Human Enhancer of Decapping Large Subunit; Hedls; HEDLS) (HRP); anti-EDC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E2
Specificity
Recognizes human EDC4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-EDC4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1302-1402 from EDC4 (NP_055144) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to EDC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to EDC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged EDC4 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EDC4 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-EDC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,728 Da
NCBI Official Full Name
enhancer of mRNA-decapping protein 4
NCBI Official Synonym Full Names
enhancer of mRNA decapping 4
NCBI Official Symbol
EDC4
NCBI Official Synonym Symbols
GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8
NCBI Protein Information
enhancer of mRNA-decapping protein 4; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit
UniProt Protein Name
Enhancer of mRNA-decapping protein 4
UniProt Gene Name
EDC4
UniProt Synonym Gene Names
HEDLS; Hedls
UniProt Entry Name
EDC4_HUMAN

Uniprot Description

EDC4: a protein required for the 5' a?? 3' pathway of mRNA decapping and degradation-based post-transcriptional gene silencing. The proteins involved in 5' a?? 3' mRNA decay include DCP2, DCP1A, EDC3, EDC4 and DDX6, and are concentrated in cytoplasmic structures called mRNA "processing bodies" (P-bodies). Shortening of the 3'-poly(A) tail and removal of PABP precedes cleavage of the 5'-mRNA cap by a complex containing decapping enzymes 1A and 2 (DCP1A/DCP2). EDC4 enhances the catalytic activity of DCP2 in vitro. Shown to be required for silencing by miRNAs in Drosophila melanogaster. Two alternatively spliced human isoforms have been described.

Protein type: RNA processing

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein binding

Biological Process: gene expression; mRNA catabolic process, deadenylation-dependent decay

Similar Products

Product Notes

The EDC4 edc4 (Catalog #AAA6152264) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EDC4 (Enhancer of mRNA-decapping Protein 4, Autoantigen Ge-1, Autoantigen RCD-8, Human Enhancer of Decapping Large Subunit, Hedls, HEDLS) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDC4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDC4 edc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.