Testing Data
(Detection limit for recombinant GST tagged ECHS1 is ~0.3ng/ml as a capture antibody.)
Mouse anti-Human ECHS1 Monoclonal Antibody | anti-ECHS1 antibody
ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Short Chain Enoyl-CoA Hydratase, SCEH, Enoyl-CoA Hydratase 1) (AP)
Gene Names
ECHS1; SCEH; ECHS1D
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ECHS1; Monoclonal Antibody; ECHS1 (Enoyl-CoA Hydratase; Mitochondrial; Short Chain Enoyl-CoA Hydratase; SCEH; Enoyl-CoA Hydratase 1) (AP); anti-ECHS1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C6
Specificity
Recognizes human ECHS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ECHS1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa13-290 from ECHS1 (AAH08906) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged ECHS1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ECHS1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-ECHS1 antibody
ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. It is a member of the hydratase/isomerase superfamily.
Product Categories/Family for anti-ECHS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
31,387 Da
NCBI Official Full Name
Homo sapiens enoyl Coenzyme A hydratase, short chain, 1, mitochondrial, mRNA
NCBI Official Synonym Full Names
enoyl-CoA hydratase, short chain 1
NCBI Official Symbol
ECHS1
NCBI Official Synonym Symbols
SCEH; ECHS1D
NCBI Protein Information
enoyl-CoA hydratase, mitochondrial
Protein Family
NCBI Description
The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq, Jul 2008]
Research Articles on ECHS1
Similar Products
Product Notes
The ECHS1 (Catalog #AAA6131050) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ECHS1 (Enoyl-CoA Hydratase, Mitochondrial, Short Chain Enoyl-CoA Hydratase, SCEH, Enoyl-CoA Hydratase 1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ECHS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ECHS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ECHS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
