Mouse anti-Human EBP1 Monoclonal Antibody | anti-EBP1 antibody

EBP1 (Proliferation-associated Protein 2G4, Cell Cycle Protein p38-2G4 Homolog, hG4-1, ErbB3-binding Protein 1, PA2G4) (HRP)

Cat. Num. AAA6152260

• Gene Names: PA2G4; EBP1; HG4-1; p38-2G4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EBP1; Monoclonal Antibody; EBP1 (Proliferation-associated Protein 2G4; Cell Cycle Protein p38-2G4 Homolog; hG4-1; ErbB3-binding Protein 1; PA2G4) (HRP); anti-EBP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A5
• Specificity: Recognizes human PA2G4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-EBP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from human PA2G4 (AAH01951) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(Western Blot analysis of PA2G4 expression in transfected 293T cell line by PA2G4 monoclonal antibody. Lane 1: PA2G4 transfected lysate (43.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PA2G4 is 1ng/ml as a capture antibody.)

Related Product Information for anti-EBP1 antibody

PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.

Product Categories/Family for anti-EBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12804994
• NCBI GeneID: 5036
• Molecular Weight: 38,059 Da
• NCBI Official Full Name: Homo sapiens proliferation-associated 2G4, 38kDa, mRNA
• NCBI Official Synonym Full Names: proliferation-associated 2G4
• NCBI Official Symbol: PA2G4
• NCBI Official Synonym Symbols: EBP1; HG4-1; p38-2G4
• NCBI Protein Information: proliferation-associated protein 2G4
• Protein Family: ERBB-3 BINDING protein

NCBI Description

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. [provided by RefSeq, Jul 2008]