Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to DYRK3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Mouse anti-Human DYRK3 Monoclonal Antibody | anti-DYRK3 antibody

DYRK3 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 3, Regulatory Erythroid Kinase, REDK) (AP)

Gene Names
DYRK3; RED; REDK; DYRK5; hYAK3-2
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DYRK3; Monoclonal Antibody; DYRK3 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 3; Regulatory Erythroid Kinase; REDK) (AP); anti-DYRK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E10
Specificity
Recognizes human DYRK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DYRK3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-569 from DYRK3 (AAH15501) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKWKEKLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHML
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to DYRK3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to DYRK3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])
Product Categories/Family for anti-DYRK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
63,977 Da
NCBI Official Full Name
Homo sapiens dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3, mRNA
NCBI Official Synonym Full Names
dual specificity tyrosine phosphorylation regulated kinase 3
NCBI Official Symbol
DYRK3
NCBI Official Synonym Symbols
RED; REDK; DYRK5; hYAK3-2
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 3

NCBI Description

This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Research Articles on DYRK3

Similar Products

Product Notes

The DYRK3 (Catalog #AAA6131032) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DYRK3 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 3, Regulatory Erythroid Kinase, REDK) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DYRK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DYRK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.