Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human DUSP5 Monoclonal Antibody | anti-DUSP5 antibody

DUSP5 (Dual Specificity Protein Phosphatase 5, Dual Specificity Protein Phosphatase hVH3, VH3) (HRP)

Gene Names
DUSP5; DUSP; HVH3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DUSP5; Monoclonal Antibody; DUSP5 (Dual Specificity Protein Phosphatase 5; Dual Specificity Protein Phosphatase hVH3; VH3) (HRP); anti-DUSP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C8
Specificity
Recognizes human DUSP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DUSP5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa286-384 from human DUSP5 (NP_004410) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(DUSP5 monoclonal antibody, Western Blot analysis of DUSP5 expression in K-562.)

Western Blot (WB) (DUSP5 monoclonal antibody, Western Blot analysis of DUSP5 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DUSP5 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DUSP5 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DUSP5 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DUSP5 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-DUSP5 antibody
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus.
Product Categories/Family for anti-DUSP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
dual specificity protein phosphatase 5
NCBI Official Synonym Full Names
dual specificity phosphatase 5
NCBI Official Symbol
DUSP5
NCBI Official Synonym Symbols
DUSP; HVH3
NCBI Protein Information
dual specificity protein phosphatase 5
UniProt Protein Name
Dual specificity protein phosphatase 5
UniProt Gene Name
DUSP5
UniProt Synonym Gene Names
VH3
UniProt Entry Name
DUS5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Displays phosphatase activity toward several substrates. The highest relative activity is toward ERK1.

Catalytic activity: Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.A phosphoprotein + H2O = a protein + phosphate.

Subcellular location: Nucleus

Potential.

Sequence similarities: Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 rhodanese domain.Contains 1 tyrosine-protein phosphatase domain.

Research Articles on DUSP5

Similar Products

Product Notes

The DUSP5 dusp5 (Catalog #AAA6152233) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DUSP5 (Dual Specificity Protein Phosphatase 5, Dual Specificity Protein Phosphatase hVH3, VH3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DUSP5 dusp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DUSP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.