Mouse DUSP3 Monoclonal Antibody | anti-DUSP3 antibody

DUSP3 (Dual Specificity Phosphatase 3, VHR) (FITC)

Cat. Num. AAA6178060

• Gene Names: DUSP3; VHR
• Applications: ELISA
• Purity: Purified
• Synonyms: DUSP3; Monoclonal Antibody; DUSP3 (Dual Specificity Phosphatase 3; VHR) (FITC); Dual Specificity Phosphatase 3; VHR; anti-DUSP3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C4
• Specificity: Recognizes DUSP3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-DUSP3 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DUSP3 (NP_004081, 76aa-185aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DUSP3 is 0.3 ng/ml as a capture antibody.)

Related Product Information for anti-DUSP3 antibody

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. [provided by RefSeq]

Product Categories/Family for anti-DUSP3 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 4758208
• NCBI GeneID: 1845
• NCBI Accession #: NP_004081
• NCBI GenBank Nucleotide #: NM_004090.3
• UniProt Accession #: P51452; Q5U0J1; Q8IYJ9; D3DX45
• Molecular Weight: 16,163 Da
• NCBI Official Full Name: dual specificity protein phosphatase 3
• NCBI Official Synonym Full Names: dual specificity phosphatase 3
• NCBI Official Symbol: DUSP3
• NCBI Official Synonym Symbols: VHR
• NCBI Protein Information: dual specificity protein phosphatase 3
• UniProt Protein Name: Dual specificity protein phosphatase 3
• Protein Family: Dual specificity protein phosphatase
• UniProt Gene Name: DUSP3
• UniProt Synonym Gene Names: VHR; VHR
• UniProt Entry Name: DUS3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. [provided by RefSeq, Jul 2008]

Uniprot Description

DUSP3: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP3 inactivates the mitogen-activated kinases Erk2 and Jnk and is phosphorylated by ZAP-70. Phosphorylation by ZAP-70 is required for DUSP3 to inhibit the Erk2-Elk-1 pathway.

Protein type: EC 3.1.3.48; Motility/polarity/chemotaxis; Protein phosphatase, dual-specificity; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleoplasm; cytoplasm; immunological synapse; cytosol; nucleus

Molecular Function: MAP kinase phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity

Biological Process: negative regulation of JNK cascade; nerve growth factor receptor signaling pathway; in utero embryonic development; negative regulation of MAPKKK cascade; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; negative regulation of T cell receptor signaling pathway; toll-like receptor 3 signaling pathway; positive regulation of mitotic cell cycle; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway; negative regulation of T cell activation; inactivation of MAPK activity