Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DMTF1 Monoclonal Antibody | anti-DMTF1 antibody

DMTF1 (DMP1, Cyclin-D-binding Myb-like Transcription Factor 1, Cyclin-D-interacting Myb-like Protein 1, hDMTF1) (MaxLight 405)

Gene Names
DMTF1; DMP1; DMTF; MRUL; hDMP1
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DMTF1; Monoclonal Antibody; DMTF1 (DMP1; Cyclin-D-binding Myb-like Transcription Factor 1; Cyclin-D-interacting Myb-like Protein 1; hDMTF1) (MaxLight 405); anti-DMTF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C6
Specificity
Recognizes human DMTF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-DMTF1 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa661-760 from DMTF1 (NP_066968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-DMTF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
cyclin-D-binding Myb-like transcription factor 1 isoform a
NCBI Official Synonym Full Names
cyclin D binding myb like transcription factor 1
NCBI Official Symbol
DMTF1
NCBI Official Synonym Symbols
DMP1; DMTF; MRUL; hDMP1
NCBI Protein Information
cyclin-D-binding Myb-like transcription factor 1
UniProt Protein Name
Cyclin-D-binding Myb-like transcription factor 1
UniProt Gene Name
DMTF1
UniProt Synonym Gene Names
DMP1; hDMTF1; hDMP1
UniProt Entry Name
DMTF1_HUMAN

NCBI Description

This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

Research Articles on DMTF1

Similar Products

Product Notes

The DMTF1 dmtf1 (Catalog #AAA6189825) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DMTF1 (DMP1, Cyclin-D-binding Myb-like Transcription Factor 1, Cyclin-D-interacting Myb-like Protein 1, hDMTF1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DMTF1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DMTF1 dmtf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DMTF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.