Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (39.09kD).)

Mouse anti-Human DMPK Monoclonal Antibody | anti-DMPK antibody

DMPK (Myotonin-protein Kinase, Myotonic Dystrophy Protein Kinase, MDPK, DM-Kinase, DMK, MT-PK, DM-kinase) (AP)

Gene Names
DMPK; DM; DM1; DMK; MDPK; DM1PK; MT-PK
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DMPK; Monoclonal Antibody; DMPK (Myotonin-protein Kinase; Myotonic Dystrophy Protein Kinase; MDPK; DM-Kinase; DMK; MT-PK; DM-kinase) (AP); anti-DMPK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes human DMPK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
2768
Applicable Applications for anti-DMPK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa303-421 from human DMPK (AAH62553) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (39.09kD).)

Western Blot (WB) (Western Blot detection against Immunogen (39.09kD).)

Western Blot (WB)

(Western Blot analysis of DMPK expression in transfected 293T cell line by DMPK monoclonal antibody. Lane 1: DMPK transfected lysate (69.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DMPK expression in transfected 293T cell line by DMPK monoclonal antibody. Lane 1: DMPK transfected lysate (69.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DMPK is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged DMPK is ~0.03ng/ml as a capture antibody)

Western Blot (WB)

(Western blot analysis of DMPK over-expressed 293 cell line, cotransfected with DMPK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DMPK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of DMPK over-expressed 293 cell line, cotransfected with DMPK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with DMPK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-DMPK antibody
DMPK, a member of the Ser/Thr protein kinase family, may play a role in intracellular communication. Most DMPK isoforms are expressed in many tissues including heart, skeletal muscle, liver and brain, except for isoform 2 which is only found in the heart and skeletal muscle, and isoform 14 which is only found in the brain, with high levels in the striatum, cerebellar cortex and pons. The poly-Gln region upstream/downstream of the gene is highly polymorphic (5 to 27 repeats) in the normal population and is expanded up to 50-3000 or more repeats in DM patients. The repeat length usually increases in successive generations, but not always. Defects in DMPK are the cause of myotonic dystrophy (DM), also known as Steinert disease. DM is an autosomal dominant neurodegenerative disorder characterized by myotonia, muscle wasting in the distal extremities, cataract, hypogonadism, defective endocrine functions, male baldness, and cardiac arrhythmias. DM patients show decreased levels of kinase expression inversely related to repeat length. The minimum estimated incidence is 1 in 8000 live births.
Product Categories/Family for anti-DMPK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens dystrophia myotonica-protein kinase, mRNA
NCBI Official Synonym Full Names
DM1 protein kinase
NCBI Official Symbol
DMPK
NCBI Official Synonym Symbols
DM; DM1; DMK; MDPK; DM1PK; MT-PK
NCBI Protein Information
myotonin-protein kinase
Protein Family

NCBI Description

The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-38 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2016]

Research Articles on DMPK

Similar Products

Product Notes

The DMPK (Catalog #AAA6130959) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DMPK (Myotonin-protein Kinase, Myotonic Dystrophy Protein Kinase, MDPK, DM-Kinase, DMK, MT-PK, DM-kinase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DMPK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DMPK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DMPK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.