Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DMC1 is 0.1 ng/ml as a capture antibody.)

Mouse DMC1 Monoclonal Antibody | anti-DMC1 antibody

DMC1 (DMC1 dosage Suppressor of mck1 Homolog, meiosis-Specific Homologous recombination (yeast), DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1) (AP)

Gene Names
DMC1; DMC1H; LIM15; dJ199H16.1
Applications
Western Blot
Purity
Purified
Synonyms
DMC1; Monoclonal Antibody; DMC1 (DMC1 dosage Suppressor of mck1 Homolog; meiosis-Specific Homologous recombination (yeast); DMC1H; HsLim15; LIM15; MGC150472; MGC150473; dJ199H16.1) (AP); DMC1 dosage Suppressor of mck1 Homolog; dJ199H16.1; anti-DMC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
400
Specificity
Recognizes DMC1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DMC1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DMC1 (NP_008999, 237aa-339aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DMC1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DMC1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-DMC1 antibody
The protein encoded by this gene is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes. Alternative splice variants of this gene have been described but their full-length nature has not been determined. [provided by RefSeq]
Product Categories/Family for anti-DMC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,559 Da
NCBI Official Full Name
meiotic recombination protein DMC1/LIM15 homolog isoform 1
NCBI Official Synonym Full Names
DNA meiotic recombinase 1
NCBI Official Symbol
DMC1
NCBI Official Synonym Symbols
DMC1H; LIM15; dJ199H16.1
NCBI Protein Information
meiotic recombination protein DMC1/LIM15 homolog; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination; disrupted meiotic cDNA1, yeast, homolog of
UniProt Protein Name
Meiotic recombination protein DMC1/LIM15 homolog
UniProt Gene Name
DMC1
UniProt Synonym Gene Names
DMC1H; LIM15

Uniprot Description

May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.

Similar Products

Product Notes

The DMC1 dmc1 (Catalog #AAA6163622) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DMC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DMC1 dmc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DMC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.