Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Mouse DLX5 Monoclonal Antibody | anti-DLX5 antibody

DLX5 (Homeobox Protein DLX-5) (HRP)

Gene Names
DLX5; SHFM1D
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLX5; Monoclonal Antibody; DLX5 (Homeobox Protein DLX-5) (HRP); anti-DLX5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B11
Specificity
Recognizes human DLX5. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DLX5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa191-279 from human DLX5 (NP_005212) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.79kD).)

Western Blot (WB)

(DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in PC-12.)

Western Blot (WB) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in PC-12.)

Western Blot (WB)

(DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in Raw 264.7.)

Western Blot (WB) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in Raw 264.7.)

Western Blot (WB)

(DLX5 monoclonal antibody, Western Blot analysis of DLX5 expression in A-431.)

Western Blot (WB) (DLX5 monoclonal antibody, Western Blot analysis of DLX5 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12). Lane 1: DLX5 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12). Lane 1: DLX5 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in NIH/3T3.)

Western Blot (WB) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in NIH/3T3.)
Related Product Information for anti-DLX5 antibody
Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding.
Product Categories/Family for anti-DLX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
homeobox protein DLX-5
NCBI Official Synonym Full Names
distal-less homeobox 5
NCBI Official Symbol
DLX5
NCBI Official Synonym Symbols
SHFM1D
NCBI Protein Information
homeobox protein DLX-5
UniProt Protein Name
Homeobox protein DLX-5
Protein Family
UniProt Gene Name
DLX5
UniProt Entry Name
DLX5_HUMAN

NCBI Description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq, Jul 2008]

Uniprot Description

DLX5: Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding. Defects in DLX5 are the cause of split-hand/foot malformation type 1, with sensorineural hearing loss (SHFM1D). A disease characterized by the association of split- hand/foot malformation with deafness. Split-hand/foot malformation is a limb malformation involving the central rays of the autopod and presenting with syndactyly, median clefts of the hands and feet, and aplasia and/or hypoplasia of the phalanges, metacarpals, and metatarsals. Some patients have been found to have mental retardation, ectodermal and craniofacial findings, and orofacial clefting. Belongs to the distal-less homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: cytoplasm; nuclear chromatin

Biological Process: nervous system development; axon guidance; inner ear morphogenesis; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; olfactory pit development; palate development; BMP signaling pathway; osteoblast differentiation; cell proliferation; positive regulation of osteoblast differentiation; epithelial cell differentiation; anatomical structure formation; skeletal development; positive regulation of epithelial cell proliferation; embryonic limb morphogenesis; endochondral ossification

Disease: Split-hand/foot Malformation 1 With Sensorineural Hearing Loss, Autosomal Recessive

Research Articles on DLX5

Similar Products

Product Notes

The DLX5 dlx5 (Catalog #AAA6152166) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLX5 (Homeobox Protein DLX-5) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DLX5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLX5 dlx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLX5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.