Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DKK1 expression in HeLa cells using 125868.)

Mouse anti-Human DKK1 Monoclonal Antibody | anti-DKK1 antibody

DKK1 (Dickkopf-related Protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK, UNQ492/PRO1008) (MaxLight 750)

Gene Names
DKK1; SK; DKK-1
Reactivity
Human
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DKK1; Monoclonal Antibody; DKK1 (Dickkopf-related Protein 1; Dickkopf-1; Dkk-1; hDkk-1; SK; UNQ492/PRO1008) (MaxLight 750); anti-DKK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B12
Specificity
Recognizes human DKK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-DKK1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-266 from DKK1 (BC001539; AAH01539) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQAS
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DKK1 expression in HeLa cells using 125868.)

Western Blot (WB) (Western Blot analysis of DKK1 expression in HeLa cells using 125868.)

Immunoprecipitation (IP)

(Immunoprecipitation of DKK1 transfected lysate using 125868 and Protein A Magnetic Bead, and immunoblotted with 125868.)

Immunoprecipitation (IP) (Immunoprecipitation of DKK1 transfected lysate using 125868 and Protein A Magnetic Bead, and immunoblotted with 125868.)

Immunohistochemistry (IHC)

(Immunoperoxidase on formalin-fixed paraffin-embedded human placenta using 125868 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase on formalin-fixed paraffin-embedded human placenta using 125868 (3ug/ml).)
Product Categories/Family for anti-DKK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
28,672 Da
NCBI Official Full Name
Homo sapiens dickkopf homolog 1 (Xenopus laevis), mRNA
NCBI Official Synonym Full Names
dickkopf WNT signaling pathway inhibitor 1
NCBI Official Symbol
DKK1
NCBI Official Synonym Symbols
SK; DKK-1
NCBI Protein Information
dickkopf-related protein 1
Protein Family

NCBI Description

This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. [provided by RefSeq, Jul 2008]

Research Articles on DKK1

Similar Products

Product Notes

The DKK1 (Catalog #AAA6232507) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DKK1 (Dickkopf-related Protein 1, Dickkopf-1, Dkk-1, hDkk-1, SK, UNQ492/PRO1008) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DKK1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DKK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DKK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.