Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CHRAC1 expression in transfected 293T cell line by CHRAC1 monoclonal antibody (M11), clone 4E7.Lane 1: CHRAC1 transfected lysate(14.7 KDa).Lane 2: Non-transfected lysate.)

Mouse CHRAC1 Monoclonal Antibody | anti-CHRAC1 antibody

CHRAC1 (Chromatin Accessibility Complex 1, CHARC1, CHARC15, CHRAC15, YCL1) (AP)

Gene Names
CHRAC1; YCL1; CHARC1; CHARC15; CHRAC-1; CHRAC15; CHRAC-15
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CHRAC1; Monoclonal Antibody; CHRAC1 (Chromatin Accessibility Complex 1; CHARC1; CHARC15; CHRAC15; YCL1) (AP); Chromatin Accessibility Complex 1; YCL1; anti-CHRAC1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
40000000
Specificity
Recognizes CHRAC1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CHRAC1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CHRAC1 (NP_059140, 1aa-96aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CHRAC1 expression in transfected 293T cell line by CHRAC1 monoclonal antibody (M11), clone 4E7.Lane 1: CHRAC1 transfected lysate(14.7 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CHRAC1 expression in transfected 293T cell line by CHRAC1 monoclonal antibody (M11), clone 4E7.Lane 1: CHRAC1 transfected lysate(14.7 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-CHRAC1 antibody
CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. [supplied by OMIM]
Product Categories/Family for anti-CHRAC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.1 kDa (154aa)
NCBI Official Full Name
chromatin accessibility complex protein 1
NCBI Official Synonym Full Names
chromatin accessibility complex 1
NCBI Official Symbol
CHRAC1
NCBI Official Synonym Symbols
YCL1; CHARC1; CHARC15; CHRAC-1; CHRAC15; CHRAC-15
NCBI Protein Information
chromatin accessibility complex protein 1
UniProt Protein Name
Chromatin accessibility complex protein 1
UniProt Gene Name
CHRAC1
UniProt Synonym Gene Names
CHRAC15; CHRAC-1; CHRAC-15; HuCHRAC15
UniProt Entry Name
CHRC1_HUMAN

NCBI Description

CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]

Uniprot Description

CHRAC1: Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: epsilon DNA polymerase complex; chromatin accessibility complex

Molecular Function: DNA binding; sequence-specific DNA binding; protein heterodimerization activity; DNA-directed DNA polymerase activity

Biological Process: chromatin remodeling

Research Articles on CHRAC1

Similar Products

Product Notes

The CHRAC1 chrac1 (Catalog #AAA6164500) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CHRAC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CHRAC1 chrac1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHRAC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.