Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse DHX8 Monoclonal Antibody | anti-DHX8 antibody

DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8, DDX8, HRH1, PRP22, PRPF22) (MaxLight 750)

Gene Names
DHX8; DDX8; Dhr2; HRH1; PRP22; PRPF22
Applications
Western Blot
Purity
Purified
Synonyms
DHX8; Monoclonal Antibody; DHX8 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 8; DDX8; HRH1; PRP22; PRPF22) (MaxLight 750); DEAH (Asp-Glu-Ala-His) Box Polypeptide 8; PRPF22; anti-DHX8 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D6
Specificity
Recognizes DHX8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-DHX8 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DHX8 (NP_004932, 301aa-400aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DHX8 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. [provided by RefSeq]
Product Categories/Family for anti-DHX8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
139kDa
NCBI Official Full Name
ATP-dependent RNA helicase DHX8 isoform 1
NCBI Official Synonym Full Names
DEAH-box helicase 8
NCBI Official Symbol
DHX8
NCBI Official Synonym Symbols
DDX8; Dhr2; HRH1; PRP22; PRPF22
NCBI Protein Information
ATP-dependent RNA helicase DHX8
UniProt Protein Name
ATP-dependent RNA helicase DHX8
UniProt Gene Name
DHX8
UniProt Synonym Gene Names
DDX8
UniProt Entry Name
DHX8_HUMAN

NCBI Description

This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

DDX8: Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. Belongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.

Protein type: RNA-binding; RNA processing; RNA splicing; EC 3.6.4.13; Helicase; Spliceosome

Chromosomal Location of Human Ortholog: 17q21.31

Cellular Component: nucleoplasm; spliceosome; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; ATP binding; ATP-dependent RNA helicase activity

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; RNA splicing

Research Articles on DHX8

Similar Products

Product Notes

The DHX8 dhx8 (Catalog #AAA6237904) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DHX8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHX8 dhx8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHX8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.