Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DHRS2 Monoclonal Antibody | anti-DHRS2 antibody

DHRS2 (Dehydrogenase/Reductase SDR Family Member 2, Dicarbonyl Reductase HEP27, Protein D) (MaxLight 650)

Gene Names
DHRS2; HEP27; SDR25C1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DHRS2; Monoclonal Antibody; DHRS2 (Dehydrogenase/Reductase SDR Family Member 2; Dicarbonyl Reductase HEP27; Protein D) (MaxLight 650); anti-DHRS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F10
Specificity
Recognizes human DHRS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-DHRS2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa229-300 from DHRS2 (NP_878912) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DHRS2 antibody
DHRS2 displays NADPH-dependent dicarbonyl reductase activity in vitro with 3,4-Hexanedione, 2,3-Heptanedione and 1-Phenyl-1,2-propanedione as substrates. DHRS2 do not reductase activity is displayed in vitro with steroids, retinoids and sugars as substrates. This protein may inhibit cell replication.
Product Categories/Family for anti-DHRS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,496 Da
NCBI Official Full Name
dehydrogenase/reductase SDR family member 2, mitochondrial isoform 1
NCBI Official Synonym Full Names
dehydrogenase/reductase (SDR family) member 2
NCBI Official Symbol
DHRS2
NCBI Official Synonym Symbols
HEP27; SDR25C1
NCBI Protein Information
dehydrogenase/reductase SDR family member 2, mitochondrial; dehydrogenase/reductase member 2; dicarbonyl reductase HEP27; protein D; short chain dehydrogenase/reductase family 25C, member 1; short-chain alcohol dehydrogenase family member
UniProt Protein Name
Dehydrogenase/reductase SDR family member 2
UniProt Gene Name
DHRS2
UniProt Entry Name
DHRS2_HUMAN

Uniprot Description

DHRS2: Displays NADPH-dependent dicarbonyl reductase activity in vitro with 3,4-Hexanedione, 2,3-Heptanedione and 1-Phenyl-1,2- propanedione as substrates. No reductase activity is displayed in vitro with steroids, retinoids and sugars as substrates. May inhibit cell replication. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.1.1.-; Oxidoreductase; EC 1.1.-.-

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: mitochondrion; mitochondrial matrix; cytoplasm; nuclear envelope; nucleus

Molecular Function: carbonyl reductase (NADPH) activity

Biological Process: negative regulation of cell proliferation; response to toxin; C21-steroid hormone metabolic process; myeloid dendritic cell differentiation; negative regulation of apoptosis

Similar Products

Product Notes

The DHRS2 dhrs2 (Catalog #AAA6221817) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHRS2 (Dehydrogenase/Reductase SDR Family Member 2, Dicarbonyl Reductase HEP27, Protein D) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHRS2 dhrs2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHRS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.