<
Western Blot (WB)
(Western Blot detection against immunogen (36.74kD).)
Mouse anti-Human, Rat DHFR Monoclonal Antibody | anti-DHFR antibody
DHFR (Dihydrofolate reductase) (MaxLight 405)
Gene Names
DHFR; DYR; DHFRP1
Reactivity
Human, Rat
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DHFR; Monoclonal Antibody; DHFR (Dihydrofolate reductase) (MaxLight 405); anti-DHFR antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes human DHFR. Species Crossreactivity: rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
1133
Applicable Applications for anti-DHFR antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa88-187 of human DHFR (BC003584; AAH03584) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against immunogen (36.74kD).)
Western Blot (WB)
(Western Blot detection against immunogen (36.74kD).)
Testing Data
(Detection limit for is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for is ~0.1ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence on HeLa cells using (10ug/ml).)
Immunofluorescence (IF)
(Immunofluorescence on HeLa cells using (10ug/ml).)
Western Blot (WB)
(Western Blot analysis of DHFR expression in HeLa.)
Western Blot (WB)
(Western Blot analysis of DHFR expression in HeLa.)
Product Categories/Family for anti-DHFR antibody
References
1. Influence of Reduced Folate Carrier and Dihydrofolate Reductase Genes on Methotrexate-Induced Cytotoxicity. Yoon SA, Choi JR, Kim JO, Shin JY, Zhang X, Kang JH.Cancer Res Treat. 2010 Sep;42(3):163-71. Epub 2010 Sep 30. 2. Telomere capping in non-dividing yeast cells requires Yku and Rap1. Vodenicharov MD, Laterreur N, Wellinger RJ.EMBO J. 2010 Jul 13. 3. Anticancer drug encapsulated in inorganic lattice can overcome drug resistance. Choi SJ, Choi GE, Oh JM, Oh YJ, Park MC, Choy JH.J. Mater. Chem., 2010, 20, 9463-9469. 4. Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes. Ionova IA, Vasquez-Vivar J, Whitsett J, Herrnreiter A, Medhora M, Cooley BC, Pieper GM.Am J Physiol Heart Circ Physiol. 2008 Nov;295(5):H2178-87. Epub 2008 Oct 3.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens dihydrofolate reductase, mRNA
NCBI Official Synonym Full Names
dihydrofolate reductase
NCBI Official Symbol
DHFR
NCBI Official Synonym Symbols
DYR; DHFRP1
NCBI Protein Information
dihydrofolate reductase
Protein Family
NCBI Description
Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2014]
Research Articles on DHFR
Similar Products
Product Notes
The DHFR (Catalog #AAA6189789) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHFR (Dihydrofolate reductase) (MaxLight 405) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHFR can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DHFR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHFR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
