Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human DGUOK Monoclonal Antibody | anti-DGUOK antibody

DGUOK (Deoxyguanosine Kinase, Mitochondrial, dGK)

Gene Names
DGUOK; dGK; MTDPS3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DGUOK; Monoclonal Antibody; DGUOK (Deoxyguanosine Kinase; Mitochondrial; dGK); Anti -DGUOK (Deoxyguanosine Kinase; anti-DGUOK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E9
Specificity
Recognizes human DGUOK.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP
Applicable Applications for anti-DGUOK antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-89 from human DGUOK with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(Western Blot analysis of DGUOK expression in transfected 293T cell line by DGUOK monoclonal antibody.|Lane 1: DGUOK transfected lysate (32.056kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DGUOK expression in transfected 293T cell line by DGUOK monoclonal antibody.|Lane 1: DGUOK transfected lysate (32.056kD).|Lane 2: Non-transfected lysate.)
Related Product Information for anti-DGUOK antibody
Mitochondrial deoxyguanosine kinase (DGUOK) is required for the phosphorylation of several deoxyribonucleosides and certain purine deoxykribonucleoside analogs widely employed as antiviral and chemotherapeutic agents. Purine deoxyribonucleoside analogs are extensively used in treatment of lymphoproliferative disorders. These compounds are administered as pro-drugs, and their efficiency is dependent on intracellular phosphorylation to the corresponding triphosphates. In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by 2 deoxyribonucleoside kinases: cytosolic deoxycytidine kinase (DCK) and mitochondrial deoxyguanosine kinase (DGUOK also known as DGK). DGUOK expression is ubiquitous, with highest levels in muscle, brain, liver and lymphoid tissues. Defects in DGUOK are a cause of mitochondrial DNA depletion syndrome (MDS). MDS is a clinically heterogeneous group of disorders characterized by a reduction in mitochondrial DNA (mtDNA) copy number. Primary mtDNA depletion is inherited as an autosomal recessive trait and may affect single organs, typically muscle or liver, or multiple tissues. Mitochondrial DNA depletion syndromes are phenotypically heterogeneous, autosomal recessive disorders characterized by tissue-specific reduction in mtDNA copy number. Affected individuals with the hepatocerebral form of mtDNA depletion syndrome have early progressive liver failure and neurologic abnormalities, hypoglycemia, and increased lactate in body fluids.
Product Categories/Family for anti-DGUOK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,056 Da
NCBI Official Full Name
deoxyguanosine kinase, mitochondrial isoform b
NCBI Official Synonym Full Names
deoxyguanosine kinase
NCBI Official Symbol
DGUOK
NCBI Official Synonym Symbols
dGK; MTDPS3
NCBI Protein Information
deoxyguanosine kinase, mitochondrial
UniProt Protein Name
Deoxyguanosine kinase, mitochondrial
UniProt Gene Name
DGUOK
UniProt Synonym Gene Names
DGK; dGK
UniProt Entry Name
DGUOK_HUMAN

NCBI Description

In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DGUOK: Required for the phosphorylation of several deoxyribonucleosides and certain nucleoside analogs widely employed as antiviral and chemotherapeutic agents. Defects in DGUOK are the cause of mitochondrial DNA depletion syndrome type 3 (MTDPS3). A disorder characterized by onset in infancy of progressive liver failure, hypoglycemia, increased lactate in body fluids, and neurologic abnormalities including hypotonia, encephalopathy, peripheral neuropathy. Affected tissues show both decreased activity of the mtDNA-encoded respiratory chain complexes and mtDNA depletion. Belongs to the DCK/DGK family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - purine; EC 2.7.1.113; Mitochondrial; Kinase, other

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: mitochondrion; mitochondrial matrix; nucleus; cytosol

Molecular Function: nucleoside kinase activity; deoxyguanosine kinase activity; ATP binding

Biological Process: purine deoxyribonucleoside metabolic process; nucleotide biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; dGTP metabolic process; guanosine metabolic process; protein amino acid phosphorylation; purine salvage; purine base metabolic process; deoxyribonucleoside monophosphate biosynthetic process

Disease: Mitochondrial Dna Depletion Syndrome 3 (hepatocerebral Type)

Research Articles on DGUOK

Similar Products

Product Notes

The DGUOK dguok (Catalog #AAA6003459) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DGUOK (Deoxyguanosine Kinase, Mitochondrial, dGK) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DGUOK can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the DGUOK dguok for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAGRLFLSR LRAPFSSMAK SPLEGVSSSR GLHAGRGPRR LSIEGNIGLH CPKSWKLAGY DVPGASTMVL HIPDIFLFEP PESTAGALP. It is sometimes possible for the material contained within the vial of "DGUOK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.