Mouse anti-Human DGUOK Monoclonal Antibody | anti-DGUOK antibody

DGUOK (Deoxyguanosine Kinase, Mitochondrial, dGK)

Cat. Num. AAA6003459

• Gene Names: DGUOK; dGK; MTDPS3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: DGUOK; Monoclonal Antibody; DGUOK (Deoxyguanosine Kinase; Mitochondrial; dGK); Anti -DGUOK (Deoxyguanosine Kinase; anti-DGUOK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E9
• Specificity: Recognizes human DGUOK.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIGLHCPKSWKLAGYDVPGASTMVLHIPDIFLFEPPESTAGALP

• Applicable Applications for anti-DGUOK antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-89 from human DGUOK with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(Western Blot analysis of DGUOK expression in transfected 293T cell line by DGUOK monoclonal antibody.|Lane 1: DGUOK transfected lysate (32.056kD).|Lane 2: Non-transfected lysate.)

Related Product Information for anti-DGUOK antibody

Mitochondrial deoxyguanosine kinase (DGUOK) is required for the phosphorylation of several deoxyribonucleosides and certain purine deoxykribonucleoside analogs widely employed as antiviral and chemotherapeutic agents. Purine deoxyribonucleoside analogs are extensively used in treatment of lymphoproliferative disorders. These compounds are administered as pro-drugs, and their efficiency is dependent on intracellular phosphorylation to the corresponding triphosphates. In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by 2 deoxyribonucleoside kinases: cytosolic deoxycytidine kinase (DCK) and mitochondrial deoxyguanosine kinase (DGUOK also known as DGK). DGUOK expression is ubiquitous, with highest levels in muscle, brain, liver and lymphoid tissues. Defects in DGUOK are a cause of mitochondrial DNA depletion syndrome (MDS). MDS is a clinically heterogeneous group of disorders characterized by a reduction in mitochondrial DNA (mtDNA) copy number. Primary mtDNA depletion is inherited as an autosomal recessive trait and may affect single organs, typically muscle or liver, or multiple tissues. Mitochondrial DNA depletion syndromes are phenotypically heterogeneous, autosomal recessive disorders characterized by tissue-specific reduction in mtDNA copy number. Affected individuals with the hepatocerebral form of mtDNA depletion syndrome have early progressive liver failure and neurologic abnormalities, hypoglycemia, and increased lactate in body fluids.

Product Categories/Family for anti-DGUOK antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 18426971
• NCBI GeneID: 1716
• NCBI Accession #: NP_550440.1
• NCBI GenBank Nucleotide #: NM_080918.2
• UniProt Accession #: Q16854; P78532; Q16759; Q4ZG09; Q96BC1
• Molecular Weight: 32,056 Da
• NCBI Official Full Name: deoxyguanosine kinase, mitochondrial isoform b
• NCBI Official Synonym Full Names: deoxyguanosine kinase
• NCBI Official Symbol: DGUOK
• NCBI Official Synonym Symbols: dGK; MTDPS3
• NCBI Protein Information: deoxyguanosine kinase, mitochondrial
• UniProt Protein Name: Deoxyguanosine kinase, mitochondrial
• UniProt Gene Name: DGUOK
• UniProt Synonym Gene Names: DGK; dGK
• UniProt Entry Name: DGUOK_HUMAN

NCBI Description

In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DGUOK: Required for the phosphorylation of several deoxyribonucleosides and certain nucleoside analogs widely employed as antiviral and chemotherapeutic agents. Defects in DGUOK are the cause of mitochondrial DNA depletion syndrome type 3 (MTDPS3). A disorder characterized by onset in infancy of progressive liver failure, hypoglycemia, increased lactate in body fluids, and neurologic abnormalities including hypotonia, encephalopathy, peripheral neuropathy. Affected tissues show both decreased activity of the mtDNA-encoded respiratory chain complexes and mtDNA depletion. Belongs to the DCK/DGK family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - purine; EC 2.7.1.113; Mitochondrial; Kinase, other

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: mitochondrion; mitochondrial matrix; nucleus; cytosol

Molecular Function: nucleoside kinase activity; deoxyguanosine kinase activity; ATP binding

Biological Process: purine deoxyribonucleoside metabolic process; nucleotide biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; dGTP metabolic process; guanosine metabolic process; protein amino acid phosphorylation; purine salvage; purine base metabolic process; deoxyribonucleoside monophosphate biosynthetic process

Disease: Mitochondrial Dna Depletion Syndrome 3 (hepatocerebral Type)