Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DGUOK AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellDGUOK is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit DGUOK Polyclonal Antibody | anti-DGUOK antibody

DGUOK Antibody - C-terminal region

Gene Names
DGUOK; dGK; NCPH; PEOB4; MTDPS3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DGUOK; Polyclonal Antibody; DGUOK Antibody - C-terminal region; anti-DGUOK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMRE
Sequence Length
277
Applicable Applications for anti-DGUOK antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DGUOK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DGUOK AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellDGUOK is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-DGUOK AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellDGUOK is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-DGUOK antibody
This is a rabbit polyclonal antibody against DGUOK. It was validated on Western Blot

Target Description: In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene.
Product Categories/Family for anti-DGUOK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
deoxyguanosine kinase, mitochondrial isoform a
NCBI Official Synonym Full Names
deoxyguanosine kinase
NCBI Official Symbol
DGUOK
NCBI Official Synonym Symbols
dGK; NCPH; PEOB4; MTDPS3
NCBI Protein Information
deoxyguanosine kinase, mitochondrial
UniProt Protein Name
Deoxyguanosine kinase, mitochondrial
UniProt Gene Name
DGUOK
UniProt Synonym Gene Names
DGK; dGK
UniProt Entry Name
DGUOK_HUMAN

NCBI Description

In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DGUOK: Required for the phosphorylation of several deoxyribonucleosides and certain nucleoside analogs widely employed as antiviral and chemotherapeutic agents. Defects in DGUOK are the cause of mitochondrial DNA depletion syndrome type 3 (MTDPS3). A disorder characterized by onset in infancy of progressive liver failure, hypoglycemia, increased lactate in body fluids, and neurologic abnormalities including hypotonia, encephalopathy, peripheral neuropathy. Affected tissues show both decreased activity of the mtDNA-encoded respiratory chain complexes and mtDNA depletion. Belongs to the DCK/DGK family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, other; Nucleotide Metabolism - purine; EC 2.7.1.113; Mitochondrial

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: mitochondrion; mitochondrial matrix; cytosol; nucleus

Molecular Function: nucleoside kinase activity; deoxyguanosine kinase activity; ATP binding

Biological Process: purine deoxyribonucleoside metabolic process; nucleotide biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; dGTP metabolic process; guanosine metabolic process; protein amino acid phosphorylation; purine base metabolic process; purine salvage; deoxyribonucleoside monophosphate biosynthetic process

Disease: Mitochondrial Dna Depletion Syndrome 3 (hepatocerebral Type)

Research Articles on DGUOK

Similar Products

Product Notes

The DGUOK dguok (Catalog #AAA3216406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGUOK Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DGUOK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DGUOK dguok for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQLHGQHEAW LIHKTTKLHF EALMNIPVLV LDVNDDFSEE VTKQEDLMRE. It is sometimes possible for the material contained within the vial of "DGUOK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.