Mouse anti-Human DENR Monoclonal Antibody | anti-DENR antibody

DENR (Density-regulated Protein, DRP, Protein DRP1, Smooth Muscle Cell-associated Protein 3, SMAP-3, DRP1, H14) (PE)

Cat. Num. AAA6157423

• Gene Names: DENR; DRP; DRP1; SMAP-3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DENR; Monoclonal Antibody; DENR (Density-regulated Protein; DRP; Protein DRP1; Smooth Muscle Cell-associated Protein 3; SMAP-3; DRP1; H14) (PE); anti-DENR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H3
• Specificity: Recognizes human DENR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-DENR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-82 from DENR (NP_003668) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.02kD).)

Western Blot (WB)

(Western Blot analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody Lane 1: DENR transfected lysate (22.092kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with DENR monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-DENR antibody

May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1.

Product Categories/Family for anti-DENR antibody

Antibodies; DNA/RNA Translation

NCBI and Uniprot Product Information

• NCBI GI #: 27501446
• NCBI GeneID: 8562
• NCBI Accession #: NP_003668
• NCBI GenBank Nucleotide #: NM_003677
• UniProt Accession #: O43583; Q9H3U6; Q9UKZ0
• Molecular Weight: Predicted: 22 kDa; ; Observed: 22 kDa
• NCBI Official Full Name: density-regulated protein
• NCBI Official Synonym Full Names: density-regulated protein
• NCBI Official Symbol: DENR
• NCBI Official Synonym Symbols: DRP; DRP1; SMAP-3
• NCBI Protein Information: density-regulated protein; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3
• UniProt Protein Name: Density-regulated protein
• Protein Family: Density-regulated protein
• UniProt Gene Name: DENR
• UniProt Synonym Gene Names: DRP1; DRP; SMAP-3
• UniProt Entry Name: DENR_HUMAN

NCBI Description

This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008]

Uniprot Description

DENR: May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Plays a role in the modulation of the translational profile of a subset of cancer- related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1. Belongs to the DENR family.

Protein type: RNA-binding; Translation

Chromosomal Location of Human Ortholog: 12q24.31

Molecular Function: protein binding; translation initiation factor activity

Biological Process: ribosome disassembly; formation of translation preinitiation complex