Mouse anti-Human DEDD Monoclonal Antibody | anti-DEDD antibody

DEDD (DEDPRO1, DEFT, Death Effector Domain-containing Protein, DEDPro1, Death Effector Domain-containing Testicular Molecule, FLDED-1) (Biotin)

Cat. Num. AAA6141512

• Gene Names: DEDD; DEFT; KE05; DEDD1; FLDED1; CASP8IP1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DEDD; Monoclonal Antibody; DEDD (DEDPRO1; DEFT; Death Effector Domain-containing Protein; DEDPro1; Death Effector Domain-containing Testicular Molecule; FLDED-1) (Biotin); anti-DEDD antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C7
• Specificity: Recognizes human DEDD.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2344

• Applicable Applications for anti-DEDD antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa91-191 from DEDD (NP_127491) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Related Product Information for anti-DEDD antibody

This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak apoptosis. Upon stimulation, this protein was found to translocate from cytoplasm to nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene.

Product Categories/Family for anti-DEDD antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1519245164
• NCBI GeneID: 9191
• NCBI Accession #: NM_032998.3
• NCBI GenBank Nucleotide #: NM_032998
• NCBI Official Full Name: Homo sapiens death effector domain containing (DEDD), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: death effector domain containing
• NCBI Official Symbol: DEDD
• NCBI Official Synonym Symbols: DEFT; KE05; DEDD1; FLDED1; CASP8IP1
• NCBI Protein Information: death effector domain-containing protein
• Protein Family: Death effector domain-containing protein

NCBI Description

This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak apoptosis. Upon stimulation, this protein was found to translocate from cytoplasm to nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]