Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.71kD).)

Mouse anti-Human DECR2 Monoclonal Antibody | anti-DECR2 antibody

DECR2 (Peroxisomal 2,4-dienoyl-CoA Reductase, pDCR, 2,4-dienoyl-CoA Reductase 2, PDCR) APC

Gene Names
DECR2; PDCR; SDR17C1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DECR2; Monoclonal Antibody; DECR2 (Peroxisomal 2; 4-dienoyl-CoA Reductase; pDCR; 2; 4-dienoyl-CoA Reductase 2; PDCR) APC; anti-DECR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A7
Specificity
Recognizes human DECR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DECR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa49-109 from human DECR2 (AAH10740) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.71kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.71kD).)

Western Blot (WB)

(DECR2 monoclonal antibody. Western Blot analysis of DECR2 expression in Jurkat)

Western Blot (WB) (DECR2 monoclonal antibody. Western Blot analysis of DECR2 expression in Jurkat)

Testing Data

(Detection limit for recombinant GST tagged DECR2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DECR2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-DECR2 antibody
Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
Product Categories/Family for anti-DECR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,589 Da
NCBI Official Full Name
Homo sapiens 2,4-dienoyl CoA reductase 2, peroxisomal, mRNA
NCBI Official Synonym Full Names
2,4-dienoyl-CoA reductase 2, peroxisomal
NCBI Official Symbol
DECR2
NCBI Official Synonym Symbols
PDCR; SDR17C1
NCBI Protein Information
peroxisomal 2,4-dienoyl-CoA reductase

Similar Products

Product Notes

The DECR2 (Catalog #AAA6136208) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DECR2 (Peroxisomal 2,4-dienoyl-CoA Reductase, pDCR, 2,4-dienoyl-CoA Reductase 2, PDCR) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DECR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DECR2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DECR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.