Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human DCTN2 Monoclonal Antibody | anti-DCTN2 antibody

DCTN2 (Dynactin Subunit 2, Dynactin Complex 50kD Subunit, DCTN-50, 50kD Dynein-associated Polypeptide, p50 Dynamitin, DCTN50)

Gene Names
DCTN2; RBP50; DCTN50; DYNAMITIN
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DCTN2; Monoclonal Antibody; DCTN2 (Dynactin Subunit 2; Dynactin Complex 50kD Subunit; DCTN-50; 50kD Dynein-associated Polypeptide; p50 Dynamitin; DCTN50); Anti -DCTN2 (Dynactin Subunit 2; anti-DCTN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1 lambda
Clone Number
2G7
Specificity
Recognizes human DCTN2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
DADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK
Applicable Applications for anti-DCTN2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa302-401 from DCTN2 (AAH00718) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(DCTN2 monoclonal antibody Western Blot analysis of DCTN2 expression in MCF-7.)

Western Blot (WB) (DCTN2 monoclonal antibody Western Blot analysis of DCTN2 expression in MCF-7.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DCTN2 on MCF-7 cell . [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DCTN2 on MCF-7 cell . [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DCTN2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DCTN2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-DCTN2 antibody
DCTN2 is a 50kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22-150kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.
Product Categories/Family for anti-DCTN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44,231 Da
NCBI Official Full Name
DCTN2 protein
NCBI Official Synonym Full Names
dynactin 2 (p50)
NCBI Official Symbol
DCTN2
NCBI Official Synonym Symbols
RBP50; DCTN50; DYNAMITIN
NCBI Protein Information
dynactin subunit 2; p50 dynamitin; dynactin complex 50 kD subunit; dynactin complex 50 kDa subunit; 50 kD dynein-associated polypeptide; 50 kDa dynein-associated polypeptide
UniProt Protein Name
Dynactin subunit 2
Protein Family
UniProt Gene Name
DCTN2
UniProt Synonym Gene Names
DCTN50; DCTN-50
UniProt Entry Name
DCTN2_HUMAN

NCBI Description

This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

dynactin 2: Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development. Belongs to the dynactin subunit 2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Motility/polarity/chemotaxis; Motor; Microtubule-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: kinetochore; dynein complex; centrosome; microtubule; dynactin complex; growth cone; membrane; cytoplasm; cytosol; vesicle

Molecular Function: protein binding; spectrin binding; motor activity

Biological Process: mitosis; cell proliferation; mitotic spindle organization and biogenesis; metabolic process; organelle organization and biogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class II; mitotic cell cycle; G2/M transition of mitotic cell cycle; melanosome transport

Research Articles on DCTN2

Similar Products

Product Notes

The DCTN2 dctn2 (Catalog #AAA6007551) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCTN2 (Dynactin Subunit 2, Dynactin Complex 50kD Subunit, DCTN-50, 50kD Dynein-associated Polypeptide, p50 Dynamitin, DCTN50) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCTN2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the DCTN2 dctn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DADTQSKVHQ LYETIQRWSP IASTLPELVQ RLVTIKQLHE QAMQFGQLLT HLDTTQQMIA NSLKDNTTLL TQVQTTMREN LATVEGNFAS IDERMKKLGK. It is sometimes possible for the material contained within the vial of "DCTN2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.