Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DCLK2 Monoclonal Antibody | anti-DCLK2 antibody

DCLK2 (Serine/Threonine-protein Kinase DCLK2, Doublecortin-like And CAM Kinase-like 2, Doublecortin-like Kinase 2, Doublecortin Domain-containing Protein 3B, CaMK-like CREB Regulatory Kinase 2, CLICK-II, CL2, DCAMKL2, DCDC3B, DCK2) (MaxLight 405)

Gene Names
DCLK2; CL2; DCK2; CLIK2; DCDC3; CLICK2; DCDC3B; DCAMKL2; CLICK-II
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DCLK2; Monoclonal Antibody; DCLK2 (Serine/Threonine-protein Kinase DCLK2; Doublecortin-like And CAM Kinase-like 2; Doublecortin-like Kinase 2; Doublecortin Domain-containing Protein 3B; CaMK-like CREB Regulatory Kinase 2; CLICK-II; CL2; DCAMKL2; DCDC3B; DCK2) (MaxLight 405); anti-DCLK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A5
Specificity
Recognizes human DCAMKL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-DCLK2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa348-438 from human DCAMKL2 (AAH32726) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DCLK2 antibody
DCAMKL2 is a protein kinase containing an N-terminal doublecortin domain highly homologous to DCX, a microtubule-associated protein with essential participation in the development of the mammalian cerebral cortex. As with other DCAMKL family members, DCAMKL2 possesses microtubule binding activity and, together with DCX, is thought to form a signaling pathway that regulates microtubules in migrating neurons.
Product Categories/Family for anti-DCLK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
85,384 Da
NCBI Official Full Name
Homo sapiens cDNA clone IMAGE:5532881
NCBI Official Synonym Full Names
doublecortin like kinase 2
NCBI Official Symbol
DCLK2
NCBI Official Synonym Symbols
CL2; DCK2; CLIK2; DCDC3; CLICK2; DCDC3B; DCAMKL2; CLICK-II
NCBI Protein Information
serine/threonine-protein kinase DCLK2

NCBI Description

This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. Mouse studies show that the DCX gene, another family member, and this gene share function in the establishment of hippocampal organization and that their absence results in a severe epileptic phenotype and lethality, as described in human patients with lissencephaly. Multiple alternatively spliced transcript variants have been identified. [provided by RefSeq, Sep 2010]

Similar Products

Product Notes

The DCLK2 (Catalog #AAA6189737) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCLK2 (Serine/Threonine-protein Kinase DCLK2, Doublecortin-like And CAM Kinase-like 2, Doublecortin-like Kinase 2, Doublecortin Domain-containing Protein 3B, CaMK-like CREB Regulatory Kinase 2, CLICK-II, CL2, DCAMKL2, DCDC3B, DCK2) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCLK2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCLK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCLK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.