Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Mouse DCAMKL1 Monoclonal Antibody | anti-DCAMKL1 antibody

DCAMKL1 (Doublecortin-like Kinase 1, DCAMKL1, DCDC3A, DCLK, KIAA0369) (Biotin)

Gene Names
DCLK1; CL1; DCLK; CLICK1; DCDC3A; DCAMKL1
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
DCAMKL1; Monoclonal Antibody; DCAMKL1 (Doublecortin-like Kinase 1; DCDC3A; DCLK; KIAA0369) (Biotin); Doublecortin-like Kinase 1; KIAA0369; anti-DCAMKL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6H4
Specificity
Recognizes DCAMKL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DCAMKL1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DCAMKL1 (NP_004725, 640aa-729aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(DCAMKL1 monoclonal antibody (M03), clone 6H4 Western Blot analysis of DCAMKL1 expression in NIH/3T3.)

Western Blot (WB) (DCAMKL1 monoclonal antibody (M03), clone 6H4 Western Blot analysis of DCAMKL1 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged DCLK1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DCLK1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-DCAMKL1 antibody
DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]). [supplied by OMIM]
Product Categories/Family for anti-DCAMKL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,681 Da
NCBI Official Full Name
serine/threonine-protein kinase DCLK1 isoform 1
NCBI Official Synonym Full Names
doublecortin-like kinase 1
NCBI Official Symbol
DCLK1
NCBI Official Synonym Symbols
CL1; DCLK; CLICK1; DCDC3A; DCAMKL1
NCBI Protein Information
serine/threonine-protein kinase DCLK1; doublecortin-like and CAM kinase-like 1; doublecortin domain-containing protein 3A
UniProt Protein Name
Serine/threonine-protein kinase DCLK1
UniProt Gene Name
DCLK1
UniProt Synonym Gene Names
DCAMKL1; DCDC3A; KIAA0369
UniProt Entry Name
DCLK1_HUMAN

NCBI Description

This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010]

Uniprot Description

DCAMKL1: a serine-threonine kinase of the CAMK family. May be involved in a calcium-signaling pathway controling neuronal migration in the developing brain. May also participate in functions of the mature nervous system. Genetic and physical interactions with Doublecortin, which causes lissencephaly. A putative marker of quiescent stem cells. Four alternatively spliced isoforms have been described.

Protein type: Kinase, protein; Nuclear receptor co-regulator; Protein kinase, CAMK; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); CAMK group; DCAMKL family

Chromosomal Location of Human Ortholog: 13q13

Cellular Component: integral to plasma membrane

Molecular Function: protein serine/threonine kinase activity; receptor signaling protein activity; ATP binding; protein kinase activity

Biological Process: nervous system development; central nervous system development; axon extension; dendrite morphogenesis; response to virus; forebrain development; neuron migration; central nervous system projection neuron axonogenesis; endosome transport; protein amino acid phosphorylation

Research Articles on DCAMKL1

Similar Products

Product Notes

The DCAMKL1 dclk1 (Catalog #AAA6170855) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DCAMKL1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCAMKL1 dclk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCAMKL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.