Mouse anti-Human DAXX Monoclonal Antibody | anti-DAXX antibody

DAXX (Death Domain-associated Protein 6, Daxx, hDaxx, Fas Death Domain-associated Protein, ETS1 associated Protein 1, EAP1, BING2, DAP6) (HRP)

Cat. Num. AAA6152075

• Gene Names: DAXX; DAP6; EAP1; BING2; SMIM40
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DAXX; Monoclonal Antibody; DAXX (Death Domain-associated Protein 6; Daxx; hDaxx; Fas Death Domain-associated Protein; ETS1 associated Protein 1; EAP1; BING2; DAP6) (HRP); anti-DAXX antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4C2
• Specificity: Recognizes human DAXX.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-DAXX antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa561-660 from human DAXX (NP_001341) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of DAXX expression in transfected 293T cell line by DAXX monoclonal antibody. Lane 1: DAXX transfected lysate (81.373kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DAXX on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged DAXX is ~1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TGFB1 and DAXX HeLa cells were stained with TGFB1 rabbit purified polyclonal 1:1200 and DAXX mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-DAXX antibody

DAXX is proposed to mediate activation of the JNK pathway and apoptosis via MAP3K5 in response to signaling from TNFRSF6 and TGFBR2. Interaction with HSPB1/HSP27 may prevent interaction with TNFRSF6 and MAP3K5 and block DAXX-mediated apoptosis. In contrast, in lymphoid cells JNC activation and TNFRSF6-mediated apoptosis may not involve DAXX. DAXX seems to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may influence TNFRSF6-dependent apoptosis thereby. This protein down-regulates basal and activated transcription, and it also seems to act as a transcriptional co-repressor and inhibits PAX3 and ETS1 through direct protein-protein interaction. DAXX modulates PAX5 activity. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively.

Product Categories/Family for anti-DAXX antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 215422388
• NCBI GeneID: 1616
• NCBI Accession #: NP_001341
• NCBI GenBank Nucleotide #: NM_001350
• UniProt Accession #: Q9UER7; Q5STR5
• Molecular Weight: 81kDa
• NCBI Official Full Name: death domain-associated protein 6 isoform a
• NCBI Official Synonym Full Names: death domain associated protein
• NCBI Official Symbol: DAXX
• NCBI Official Synonym Symbols: DAP6; EAP1; BING2; SMIM40
• NCBI Protein Information: death domain-associated protein 6
• UniProt Protein Name: Death domain-associated protein 6
• Protein Family: Death domain-associated protein
• UniProt Gene Name: DAXX
• UniProt Synonym Gene Names: BING2; DAP6; hDaxx; EAP1
• UniProt Entry Name: DAXX_HUMAN

NCBI Description

This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]

Uniprot Description

DAXX: a transcriptional co-regulatory protein. Proposed to mediate activation of the JNK pathway and apoptosis via ASK1 in response to signaling from FAS and TGF-betaR2. Glucose deprivation activates the ASK1-SEK1-JNK1-HIPK1 pathway, relocalizing Daxx from the nucleus to the cytoplasm, where Daxx binds to ASK1, and subsequently leads to ASK1 oligomerization. Interaction with HSP27 may prevent interaction with TGF-betaR2 and ASK1 and block DAXX-mediated apoptosis. Seems to act as a transcriptional co- repressor and inhibits PAX3 and ETS1 through direct protein- protein interaction. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively. Two alternatively spliced isoforms have been described.

Protein type: Apoptosis; Transcription, coactivator/corepressor; Nucleolus; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: heterochromatin; PML body; cytoplasm; nucleolus; nucleus; cytosol; chromosome, pericentric region

Molecular Function: protein homodimerization activity; histone binding; p53 binding; protein N-terminus binding; protein kinase binding; transcription factor binding; protein binding; enzyme binding; androgen receptor binding; heat shock protein binding; ubiquitin protein ligase binding; receptor signaling protein activity; protein kinase activator activity; transcription corepressor activity

Biological Process: viral reproduction; transcription, DNA-dependent; regulation of protein ubiquitination; apoptosis; activation of JNK activity; chromatin remodeling; nucleosome assembly; cytokinesis after mitosis; regulation of transcription, DNA-dependent; induction of apoptosis via death domain receptors; positive regulation of protein kinase activity; androgen receptor signaling pathway; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent