Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (56.91kD).)

Mouse anti-Human DAPP1 Monoclonal Antibody | anti-DAPP1 antibody

DAPP1 (Dual Adapter for Phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, hDAPP1, B Lymphocyte Adapter Protein Bam32, B-cell Adapter Molecule of 32 kDa, BAM32, HSPC066, DKFZp667E0716)

Gene Names
DAPP1; BAM32
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DAPP1; Monoclonal Antibody; DAPP1 (Dual Adapter for Phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; hDAPP1; B Lymphocyte Adapter Protein Bam32; B-cell Adapter Molecule of 32 kDa; BAM32; HSPC066; DKFZp667E0716); Anti -DAPP1 (Dual Adapter for Phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; anti-DAPP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E1
Specificity
Recognizes human DAPP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILR
Applicable Applications for anti-DAPP1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full-length recombinant corresponding to aa1-281 from humman DAPP1 (AAH12924) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (56.91kD).)

Western Blot (WB) (Western Blot detection against Immunogen (56.91kD).)

Western Blot (WB)

(Western Blot analysis of DAPP1 expression in transfected 293T cell line by DAPP1 monoclonal antibody.|Lane 1: DAPP1 transfected lysate (Predicted MW: 32.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DAPP1 expression in transfected 293T cell line by DAPP1 monoclonal antibody.|Lane 1: DAPP1 transfected lysate (Predicted MW: 32.2kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DAPP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DAPP1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-DAPP1 antibody
May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
Product Categories/Family for anti-DAPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32,194 Da
NCBI Official Full Name
DAPP1 protein
NCBI Official Synonym Full Names
dual adaptor of phosphotyrosine and 3-phosphoinositides
NCBI Official Symbol
DAPP1
NCBI Official Synonym Symbols
BAM32
NCBI Protein Information
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; hDAPP1; B-cell adapter molecule of 32 kDa; b lymphocyte adapter protein Bam32
UniProt Protein Name
Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
UniProt Gene Name
DAPP1
UniProt Synonym Gene Names
BAM32; hDAPP1
UniProt Entry Name
DAPP1_HUMAN

Uniprot Description

DAPP1: an adaptor protein. Regulates antigen receptor signaling downstream of phosphatidylinositol 3-kinase.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q25-q27

Cellular Component: plasma membrane; cytosol

Molecular Function: phosphatidylinositol-3,4,5-triphosphate binding; phospholipid binding; phosphatidylinositol-3,4-bisphosphate binding

Biological Process: protein amino acid dephosphorylation; signal transduction

Research Articles on DAPP1

Similar Products

Product Notes

The DAPP1 dapp1 (Catalog #AAA6005539) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAPP1 (Dual Adapter for Phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, hDAPP1, B Lymphocyte Adapter Protein Bam32, B-cell Adapter Molecule of 32 kDa, BAM32, HSPC066, DKFZp667E0716) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAPP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the DAPP1 dapp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRAELLEGK MSTQDPSDLW SRSDGEAELL QDLGWYHGNL TRHAAEALLL SNGCDGSYLL RDSNETTGLY SLSVRAKDSV KHFHVEYTGY SFKFGFNEFS SLKDFVKHFA NQPLIGSETG TLMVLKHPYP RKVEEPSIYE SVRVHTAMQT GRTEDDLVPT APSLGTKEGY LTKQGGLVKT WKTRWFTLHR NELKYFKDQM SPEPIRILDL TECSAVQFDY SQERVNCFCL VFPFRTFYLC AKTGVEADEW IKILR. It is sometimes possible for the material contained within the vial of "DAPP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.