Testing Data
(Detection limit for recombinant GST tagged DAPK1 is ~0.1ng/ml as a capture antibody.)
Mouse anti-Human DAPK1 Monoclonal Antibody | anti-DAPK1 antibody
DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (AP)
Gene Names
DAPK1; DAPK
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DAPK1; Monoclonal Antibody; DAPK1 (Death-associated Protein Kinase 1; DAP Kinase 1; DAPK) (AP); anti-DAPK1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E7
Specificity
Recognizes human DAPK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DAPK1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1211-1310 from human DAPK1 (NP_004929) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LLLDSVCSTIENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged DAPK1 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DAPK1 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DAPK1. HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DAPK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Testing Data
(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DAPK1. HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DAPK1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-DAPK1 antibody
DAPK1, a DAPK type protein kinase, is a positive mediator of gamma-interferon induced programmed cell death. It is believed to function in an early apoptotic checkpoint designed to eliminate premalignant cells from cancer development. The DAPK1 protein contains eight ankyrin repeats and two putative P-loop consensus sites. Loss of DAPK1 expression has been associated with invasive tumors.
Product Categories/Family for anti-DAPK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
152,467 Da
NCBI Official Full Name
death-associated protein kinase 1
NCBI Official Synonym Full Names
death-associated protein kinase 1
NCBI Official Symbol
DAPK1
NCBI Official Synonym Symbols
DAPK
NCBI Protein Information
death-associated protein kinase 1; DAP kinase 1
UniProt Protein Name
Death-associated protein kinase 1
Protein Family
UniProt Gene Name
DAPK1
UniProt Synonym Gene Names
DAPK; DAP kinase 1
UniProt Entry Name
DAPK1_HUMAN
Similar Products
Product Notes
The DAPK1 dapk1 (Catalog #AAA6130859) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAPK1 (Death-associated Protein Kinase 1, DAP Kinase 1, DAPK) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAPK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAPK1 dapk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAPK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
