Mouse anti-Human DAP3 Monoclonal Antibody | anti-DAP3 antibody

DAP3 (28S Ribosomal Protein S29, Mitochondrial, MRP-S29, S29mt, Death-associated Protein 3, DAP-3 Ionizing Radiation Resistance Conferring Protein, MRPS29, DKFZp686G12159, MGC126058, MGC126059) (AP)

Cat. Num. AAA6130857

• Gene Names: DAP3; DAP-3; S29mt; MRPS29; MRP-S29; bMRP-10
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DAP3; Monoclonal Antibody; DAP3 (28S Ribosomal Protein S29; Mitochondrial; MRP-S29; S29mt; Death-associated Protein 3; DAP-3 Ionizing Radiation Resistance Conferring Protein; MRPS29; DKFZp686G12159; MGC126058; MGC126059) (AP); anti-DAP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B7
• Specificity: Recognizes human DAP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-DAP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa237-343 from DAP3 (NP_004623) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPI
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.88kD).)

Related Product Information for anti-DAP3 antibody

Mammalian mitochondrial ribosomal proteins help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This protein is 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27.

Product Categories/Family for anti-DAP3 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 4758118
• NCBI GeneID: 7818
• NCBI Accession #: NP_004623
• NCBI GenBank Nucleotide #: NM_004632
• UniProt Accession #: P51398
• Molecular Weight: 44kDa
• NCBI Official Full Name: 28S ribosomal protein S29, mitochondrial isoform 1
• NCBI Official Synonym Full Names: death associated protein 3
• NCBI Official Symbol: DAP3
• NCBI Official Synonym Symbols: DAP-3; S29mt; MRPS29; MRP-S29; bMRP-10
• NCBI Protein Information: 28S ribosomal protein S29, mitochondrial
• UniProt Protein Name: 28S ribosomal protein S29, mitochondrial
• Protein Family: 28S ribosomal protein
• UniProt Gene Name: DAP3
• UniProt Synonym Gene Names: MRPS29; MRP-S29; S29mt; DAP-3
• UniProt Entry Name: RT29_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that also participates in apoptotic pathways which are initiated by tumor necrosis factor-alpha, Fas ligand, and gamma interferon. This protein potentially binds ATP/GTP and might be a functional partner of the mitoribosomal protein S27. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq, Dec 2010]

Uniprot Description

DAP3: Involved in mediating interferon-gamma-induced cell death. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Apoptosis; Mitochondrial

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: nucleoplasm; small ribosomal subunit; mitochondrion; mitochondrial inner membrane; mitochondrial ribosome; nucleolus; nucleus

Molecular Function: protein binding

Biological Process: apoptotic mitochondrial changes; mitochondrial translation; organelle organization and biogenesis