Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD55 is 0.1 ng/ml as a capture antibody.)

Mouse DAF Monoclonal Antibody | anti-DAF antibody

DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (HRP)

Gene Names
CD55; CR; TC; DAF; CROM; CHAPLE
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
DAF; Monoclonal Antibody; DAF (CD55 Molecule; Decay Accelerating Factor for Complement (Cromer Blood Group); CR; CROM; TC) (HRP); CD55 Molecule; TC; anti-DAF antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D7
Specificity
Recognizes DAF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DAF antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DAF (NP_000565, 35aa-134aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD55 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD55 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M02), clone 1D7.Lane 1: CD55 transfected lysate (41.4 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M02), clone 1D7.Lane 1: CD55 transfected lysate (41.4 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CD55 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CD55 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CD55 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CD55 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-DAF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36kDa (328aa) 40-57kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
complement decay-accelerating factor isoform 1 preproprotein
NCBI Official Synonym Full Names
CD55 molecule (Cromer blood group)
NCBI Official Symbol
CD55
NCBI Official Synonym Symbols
CR; TC; DAF; CROM; CHAPLE
NCBI Protein Information
complement decay-accelerating factor
UniProt Protein Name
Complement decay-accelerating factor
UniProt Gene Name
CD55
UniProt Synonym Gene Names
CR; DAF
UniProt Entry Name
DAF_HUMAN

NCBI Description

This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins. [provided by RefSeq, Jul 2014]

Uniprot Description

CD55: This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Belongs to the receptors of complement activation (RCA) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell surface

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: cell surface; integral to plasma membrane; extracellular region; plasma membrane; lipid raft

Molecular Function: viral receptor activity; protein binding; lipid binding

Biological Process: respiratory burst; entry of virus into host cell; elevation of cytosolic calcium ion concentration; negative regulation of complement activation; regulation of complement activation; innate immune response; regulation of lipopolysaccharide-mediated signaling pathway; complement activation, classical pathway

Disease: Blood Group, Cromer System

Research Articles on DAF

Similar Products

Product Notes

The DAF cd55 (Catalog #AAA6181902) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DAF can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAF cd55 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.