Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged DACT1 is 1 ng/ml as a capture antibody.)

Mouse DACT1 Monoclonal Antibody | anti-DACT1 antibody

DACT1 (Capper, Antagonist of beta-Catenin, Homolog 1 (Xenopus laevis), DAPPER, DAPPER1, DPR1, FRODO, HDPR1, THYEX3) (FITC)

Gene Names
DACT1; DPR1; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
Applications
Western Blot
Purity
Purified
Synonyms
DACT1; Monoclonal Antibody; DACT1 (Capper; Antagonist of beta-Catenin; Homolog 1 (Xenopus laevis); DAPPER; DAPPER1; DPR1; FRODO; HDPR1; THYEX3) (FITC); Capper; THYEX3; anti-DACT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D8
Specificity
Recognizes DACT1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-DACT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DACT1 (NP_057735.2, 738aa-836aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DACT1 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DACT1 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-DACT1 antibody
Mouse monoclonal antibody raised against a partial recombinant DACT1.
Product Categories/Family for anti-DACT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,212 Da
NCBI Official Full Name
dapper homolog 1 isoform 1
NCBI Official Synonym Full Names
dishevelled-binding antagonist of beta-catenin 1
NCBI Official Symbol
DACT1
NCBI Official Synonym Symbols
DPR1; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
NCBI Protein Information
dapper homolog 1; dapper antagonist of catenin 1; heptacellular carcinoma novel gene 3; dapper, antagonist of beta-catenin, homolog 1; hepatocellular carcinoma novel gene 3 protein
UniProt Protein Name
Dapper homolog 1
Protein Family
UniProt Gene Name
DACT1
UniProt Synonym Gene Names
DPR1; HNG3; hDPR1
UniProt Entry Name
DACT1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this mRNA from xenopus embryos resulted in loss of notochord and head structures, and mice lacking this gene died shortly after birth from severe posterior malformations. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

DACT1: Positively regulates DVL2-mediated signaling pathways during development. Binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway. Interacts with DVL1 and DVL2. Belongs to the dapper family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: nucleoplasm; cytoplasm; synapse; cell junction; beta-catenin destruction complex; cytosol

Molecular Function: protein binding; protein kinase C binding; protein kinase A binding; beta-catenin binding

Biological Process: negative regulation of JNK cascade; negative regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; dendrite morphogenesis; positive regulation of protein catabolic process; synapse organization and biogenesis; positive regulation of fat cell differentiation; regulation of protein stability; gastrulation with mouth forming second; negative regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; embryonic hindgut morphogenesis

Research Articles on DACT1

Similar Products

Product Notes

The DACT1 dact1 (Catalog #AAA6178906) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DACT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DACT1 dact1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DACT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.