Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CYP26B1 is 0.1 ng/ml as a capture antibody.)

Mouse CYP26B1 Monoclonal Antibody | anti-CYP26B1 antibody

CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1, CYP26A2, DKFZp686G0638, MGC129613, P450RAI-2) (APC)

Gene Names
CYP26B1; RHFCA; CYP26A2; P450RAI2; P450RAI-2
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CYP26B1; Monoclonal Antibody; CYP26B1 (Cytochrome P450; Family 26; Subfamily B; Polypeptide 1; CYP26A2; DKFZp686G0638; MGC129613; P450RAI-2) (APC); Cytochrome P450; P450RAI-2; anti-CYP26B1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G7
Specificity
Recognizes CYP26B1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CYP26B1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CYP26B1 (NP_063938, 131aa-230aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CYP26B1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP26B1 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M02), clone 2G7.Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYP26B1 expression in transfected 293T cell line by CYP26B1 monoclonal antibody (M02), clone 2G7.Lane 1: CYP26B1 transfected lysate (Predicted MW: 57.5 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CYP26B1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CYP26B1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CYP26B1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CYP26B1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-CYP26B1 antibody
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid. [provided by RefSeq]
Product Categories/Family for anti-CYP26B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,756 Da
NCBI Official Full Name
cytochrome P450 26B1 isoform 1
NCBI Official Synonym Full Names
cytochrome P450, family 26, subfamily B, polypeptide 1
NCBI Official Symbol
CYP26B1
NCBI Official Synonym Symbols
RHFCA; CYP26A2; P450RAI2; P450RAI-2
NCBI Protein Information
cytochrome P450 26B1; cytochrome P450 retinoic acid-inactivating 2; cytochrome P450 retinoid metabolizing protein; cytochrome P450, subfamily XXVIB, polypeptide 1; retinoic acid-metabolizing cytochrome
UniProt Protein Name
Cytochrome P450 26B1
Protein Family
UniProt Gene Name
CYP26B1
UniProt Synonym Gene Names
CYP26A2; P450RAI2; Cytochrome P450RAI-2
UniProt Entry Name
CP26B_HUMAN

Uniprot Description

CYP26B1: Involved in the metabolism of retinoic acid (RA), rendering this classical morphogen inactive through oxidation. Involved in the specific inactivation of all-trans-retinoic acid (all-trans-RA), with a preference for the following substrates: all-trans-RA > 9-cis-RA > 13-cis-RA. Generates several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA, and 18-OH- RA. Esential for postnatal survival. Plays a central role in germ cell development: acts by degrading RA in the developing testis, preventing STRA8 expression, thereby leading to delay of meiosis. Required for the maintenance of the undifferentiated state of male germ cells during embryonic development in Sertoli cells, inducing arrest in G0 phase of the cell cycle and preventing meiotic entry. Plays a role in skeletal development, both at the level of patterning and in the ossification of bone and the establishment of some synovial joints. Defects in CYP26B1 are the cause of radiohumeral fusions with other skeletal and craniofacial anomalies (RHFCA). A disease characterized by craniofacial malformations, occipital encephalocele, radiohumeral fusions, oligodactyly, advanced osseous maturation, and calvarial mineralization defects. Belongs to the cytochrome P450 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Cell development/differentiation; Cofactor and Vitamin Metabolism - retinol; EC 1.14.-.-

Chromosomal Location of Human Ortholog: 2p13.2

Cellular Component: endoplasmic reticulum membrane; cytoplasm

Molecular Function: retinoic acid binding; iron ion binding; retinoic acid 4-hydroxylase activity; heme binding

Biological Process: retinoic acid receptor signaling pathway; negative regulation of retinoic acid receptor signaling pathway; tongue morphogenesis; vitamin metabolic process; xenobiotic metabolic process; spermatogenesis; cell fate determination; male meiosis; proximal/distal pattern formation; embryonic limb morphogenesis

Disease: Radiohumeral Fusions With Other Skeletal And Craniofacial Anomalies

Similar Products

Product Notes

The CYP26B1 cyp26b1 (Catalog #AAA6169432) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CYP26B1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP26B1 cyp26b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP26B1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.