Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human Thyroid Peroxidase Monoclonal Antibody | anti-TPO antibody

Thyroid Peroxidase (TPO) APC

Gene Names
TPO; MSA; TPX; TDH2A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Thyroid Peroxidase; Monoclonal Antibody; Thyroid Peroxidase (TPO) APC; EC=1.11.1.8; MSA; TDH2A; TPX; anti-TPO antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A11
Specificity
Recognizes human TPO.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
3152
Applicable Applications for anti-TPO antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa672-779 from human TPO (NP_000538) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(Western Blot analysis of TPO expression in transfected 293T cell line by TPO monoclonal antibody. Lane 1: TPO transfected lysate (102.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TPO expression in transfected 293T cell line by TPO monoclonal antibody. Lane 1: TPO transfected lysate (102.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TPO is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TPO is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-TPO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens thyroid peroxidase (TPO), transcript variant 1, mRNA
NCBI Official Synonym Full Names
thyroid peroxidase
NCBI Official Symbol
TPO
NCBI Official Synonym Symbols
MSA; TPX; TDH2A
NCBI Protein Information
thyroid peroxidase
UniProt Protein Name
Thyroid peroxidase
Protein Family
UniProt Gene Name
TPO
UniProt Synonym Gene Names
TPO
UniProt Entry Name
PERT_HUMAN

NCBI Description

This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, May 2011]

Uniprot Description

TPO: Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4). An alternative splicing in the thyroperoxidase mRNA can cause Graves' disease. Defects in TPO are the cause of thyroid dyshormonogenesis 2A (TDH2A). A disorder due to defective conversion of accumulated iodide to organically bound iodine. The iodide organification defect can be partial or complete. Belongs to the peroxidase family. XPO subfamily. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; EC 1.11.1.8; Oxidoreductase; Amino Acid Metabolism - tyrosine; Mitochondrial

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: extracellular space; cell surface; mitochondrion; integral to plasma membrane; plasma membrane

Molecular Function: peroxidase activity; heme binding; iodide peroxidase activity; calcium ion binding

Biological Process: embryonic hemopoiesis; hydrogen peroxide catabolic process; thyroid hormone generation; hormone biosynthetic process; response to oxidative stress

Disease: Thyroid Dyshormonogenesis 2a

Research Articles on TPO

Similar Products

Product Notes

The TPO tpo (Catalog #AAA6139502) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Thyroid Peroxidase (TPO) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Thyroid Peroxidase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPO tpo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Thyroid Peroxidase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.