Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human CYP24A1 Monoclonal Antibody | anti-CYP24A1 antibody

CYP24A1 (1,25-dihydroxyvitamin D(3) 24-hydroxylase, Mitochondrial, Vitamin D(3) 24-hydroxylase, 24-OHase, Cytochrome P450 24A1, Cytochrome P450-CC24, CYP24) (FITC)

Gene Names
CYP24A1; CP24; HCAI; CYP24; P450-CC24
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYP24A1; Monoclonal Antibody; CYP24A1 (1; 25-dihydroxyvitamin D(3) 24-hydroxylase; Mitochondrial; Vitamin D(3) 24-hydroxylase; 24-OHase; Cytochrome P450 24A1; Cytochrome P450-CC24; CYP24) (FITC); anti-CYP24A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E1
Specificity
Recognizes human CYP24A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CYP24A1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa415-514 from human CYP24A1 (NP_000773) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CYP24A1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP24A1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-CYP24A1 antibody
CYP24A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system.
Product Categories/Family for anti-CYP24A1 antibody
References
1. Dysregulation of renal vitamin D metabolism in the uremic rat. Helvig CF, Cuerrier D, Hosfield CM, Ireland B, Kharebov AZ, Kim JW, Ramjit NJ, Ryder K, Tabash SP, Herzenberg AM, Epps TM, Petkovich M.Kidney Int. 2010 Jun 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,051 Da
NCBI Official Full Name
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial isoform 1
NCBI Official Synonym Full Names
cytochrome P450, family 24, subfamily A, polypeptide 1
NCBI Official Symbol
CYP24A1
NCBI Official Synonym Symbols
CP24; HCAI; CYP24; P450-CC24
NCBI Protein Information
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; 1,25-@dihydroxyvitamin D3 24-hydroxylase; 24-OHase; cytochrome P450 24A1; cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase); cytoc
UniProt Protein Name
1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
UniProt Gene Name
CYP24A1
UniProt Synonym Gene Names
CYP24; 24-OHase; Vitamin D(3) 24-hydroxylase
UniProt Entry Name
CP24A_HUMAN

Similar Products

Product Notes

The CYP24A1 cyp24a1 (Catalog #AAA6146746) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYP24A1 (1,25-dihydroxyvitamin D(3) 24-hydroxylase, Mitochondrial, Vitamin D(3) 24-hydroxylase, 24-OHase, Cytochrome P450 24A1, Cytochrome P450-CC24, CYP24) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP24A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP24A1 cyp24a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP24A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.