Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MEN1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MEN1 Polyclonal Antibody | anti-MEN1 antibody

MEN1 Antibody - middle region

Gene Names
MEN1; MEAI; SCG2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MEN1; Polyclonal Antibody; MEN1 Antibody - middle region; anti-MEN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRK
Sequence Length
615
Applicable Applications for anti-MEN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MEN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MEN1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MEN1Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MEN1 antibody
This gene encodes menin, a putative tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. In vitro studies have shown menin is localized to the nucleus, possesses two functional nuclear localization signals, and inhibits transcriptional activation by JunD, however, the function of this protein is not known. Two messages have been detected on northern blots but the larger message has not been characterized. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67 kDa
NCBI Official Full Name
menin isoform 1
NCBI Official Synonym Full Names
menin 1
NCBI Official Symbol
MEN1
NCBI Official Synonym Symbols
MEAI; SCG2
NCBI Protein Information
menin
UniProt Protein Name
Menin
Protein Family
UniProt Gene Name
MEN1
UniProt Synonym Gene Names
SCG2
UniProt Entry Name
MEN1_HUMAN

NCBI Description

This gene encodes menin, a putative tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. In vitro studies have shown menin is localized to the nucleus, possesses two functional nuclear localization signals, and inhibits transcriptional activation by JunD, however, the function of this protein is not known. Two messages have been detected on northern blots but the larger message has not been characterized. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008]

Uniprot Description

MEN1: Essential component of a MLL/SET1 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3 (H3K4). Functions as a transcriptional regulator. Binds to the TERT promoter and represses telomerase expression. Plays a role in TGFB1-mediated inhibition of cell-proliferation, possibly regulating SMAD3 transcriptional activity. Represses JUND-mediated transcriptional activation on AP1 sites, as well as that mediated by NFKB subunit RELA. Positively regulates HOXC8 and HOXC6 gene expression. May be involved in normal hematopoiesis through the activation of HOXA9 expression. May be involved in DNA repair. Component of MLL-containing complexes (named MLL, ASCOM, MLL2/MLL3 or MLL3/MLL4 complex): at least composed ASH2L, RBBP5, DPY30, WDR5, one or several histone methyltransferases (MLL, MLL2, MLL3 and/or MLL4), and the facultative components MEN1, HCFC1, HCFC2, NCOA6, KDM6A, PAXIP1/PTIP and C16orf53/PA1. Interacts with POLR2A phosphorylated at 'Ser-5', but not with the unphosphorylated, nor 'Ser-2' phosphorylated POLR2A forms. Interacts with FANCD2 and DBF4. Interacts with JUND. Interacts with SMAD3, but not with SMAD2, nor SMAD4. Directly interacts with NFKB1, NFKB2 and RELA. Ubiquitous. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; histone methyltransferase complex; protein complex; nuclear matrix; cytoplasm; cytosol; nucleus; chromatin; cleavage furrow

Molecular Function: protein binding, bridging; Y-form DNA binding; protein binding; four-way junction DNA binding; sequence-specific DNA binding; double-stranded DNA binding; protein N-terminus binding; chromatin binding; histone-lysine N-methyltransferase activity

Biological Process: negative regulation of JNK cascade; maternal process involved in pregnancy; positive regulation of protein binding; positive regulation of caspase activity; palate development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of cell cycle; negative regulation of cell proliferation; negative regulation of protein amino acid phosphorylation; transforming growth factor beta receptor signaling pathway; response to gamma radiation; negative regulation of osteoblast differentiation; hemopoiesis; cell cycle arrest; response to UV; leukocyte homeostasis; transcription initiation from RNA polymerase II promoter; positive regulation of histone methylation; transcription, DNA-dependent; negative regulation of transcription factor activity; positive regulation of transforming growth factor beta receptor signaling pathway; MAPKKK cascade; negative regulation of cyclin-dependent protein kinase activity; negative regulation of organ growth; DNA repair; regulation of activin receptor signaling pathway; osteoblast development; embryonic skeletal morphogenesis; chromatin remodeling; negative regulation of telomerase activity; positive regulation of osteoblast differentiation; positive regulation of cell division; positive regulation of transcription from RNA polymerase II promoter; gene expression; brain development; negative regulation of transcription, DNA-dependent; response to DNA damage stimulus; osteoblast fate commitment

Disease: Multiple Endocrine Neoplasia, Type I

Research Articles on MEN1

Similar Products

Product Notes

The MEN1 men1 (Catalog #AAA3223457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEN1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MEN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEN1 men1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVFGPNGEQT AEVTWHGKGN EDRRGQTVNA GVAERSWLYL KGSYMRCDRK. It is sometimes possible for the material contained within the vial of "MEN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.