Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Mouse anti-Human Cyclophilin G Monoclonal Antibody | anti-PPIG antibody

Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Rotamase G, PPIG, Clk-associating RS-cyclophilin, CARS-cyclophilin, CARS-Cyp, SR-cyclophilin, SR-cyp, SRcyp, CASP10, PPIG) APC

Gene Names
PPIG; CYP; SRCyp; SCAF10; CARS-Cyp
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cyclophilin G; Monoclonal Antibody; Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G; Peptidyl-prolyl Isomerase G; PPIase G; Rotamase G; PPIG; Clk-associating RS-cyclophilin; CARS-cyclophilin; CARS-Cyp; SR-cyclophilin; SR-cyp; SRcyp; CASP10; PPIG) APC; anti-PPIG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F8
Specificity
Recognizes human PPIG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PPIG antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa13-106 from PPIG (NP_004783) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PPIG on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PPIG on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PPIG on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PPIG on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PPIG is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPIG is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-PPIG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
754
NCBI Official Full Name
Peptidyl-prolyl cis-trans isomerase G
NCBI Official Synonym Full Names
peptidylprolyl isomerase G (cyclophilin G)
NCBI Official Symbol
PPIG
NCBI Official Synonym Symbols
CYP; SRCyp; SCAF10; CARS-Cyp
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase G; CASP10; SR-cyp; PPIase G; rotamase G; cyclophilin G; SR-cyclophilin; CARS-cyclophilin; Clk-associating RS-cyclophilin; SR-related CTD-associated factor 10; peptidyl-prolyl isomerase G (cyclophilin G)
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase G
UniProt Gene Name
PPIG
UniProt Synonym Gene Names
PPIase G; Peptidyl-prolyl isomerase G; CARS-Cyp; CARS-cyclophilin; SR-cyclophilin; SR-cyp; SRcyp
UniProt Entry Name
PPIG_HUMAN

Uniprot Description

PPIG: an ubiquitous peptidyl-prolyl cis/trans isomerase. Distributed in nuclear speckles, which are rich in splicing factors. Colocalizes with the splicing factor SFRS2. A component of splicing factor complexes that bind the phosphorylated C-terminal domain (CTD) of RNA polymerase II. Interacts with CLK1 and PNN. Two splice variant isoforms of the human protein have been described.

Protein type: Isomerase; EC 5.2.1.8; Cyclophilin

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: nucleoplasm; nuclear matrix; cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; cyclosporin A binding

Biological Process: protein peptidyl-prolyl isomerization; protein folding; RNA splicing

Research Articles on PPIG

Similar Products

Product Notes

The PPIG ppig (Catalog #AAA6136131) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cyclophilin G (Peptidyl-prolyl Cis-trans Isomerase G, Peptidyl-prolyl Isomerase G, PPIase G, Rotamase G, PPIG, Clk-associating RS-cyclophilin, CARS-cyclophilin, CARS-Cyp, SR-cyclophilin, SR-cyp, SRcyp, CASP10, PPIG) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclophilin G can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPIG ppig for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclophilin G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.