Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CYB5R3 is 1ng/ml as a capture antibody.)

Mouse anti-Human CYB5R3 Monoclonal Antibody | anti-CYB5R3 antibody

CYB5R3 (NADH-cytochrome b5 Reductase 3, B5R, Cytochrome b5 Reductase, Diaphorase-1, DIA1) APC

Gene Names
CYB5R3; B5R; DIA1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYB5R3; Monoclonal Antibody; CYB5R3 (NADH-cytochrome b5 Reductase 3; B5R; Cytochrome b5 Reductase; Diaphorase-1; DIA1) APC; anti-CYB5R3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A9
Specificity
Recognizes human CYB5R3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1922
Applicable Applications for anti-CYB5R3 antibody
ELISA (EIA)
Application Notes
Sandwich ELISA: The detection limit is 1ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa157-252 from human CYB5R3 (AAH04821.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CYB5R3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYB5R3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-CYB5R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens cytochrome b5 reductase 3, mRNA
NCBI Official Synonym Full Names
cytochrome b5 reductase 3
NCBI Official Symbol
CYB5R3
NCBI Official Synonym Symbols
B5R; DIA1
NCBI Protein Information
NADH-cytochrome b5 reductase 3

NCBI Description

This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010]

Research Articles on CYB5R3

Similar Products

Product Notes

The CYB5R3 (Catalog #AAA6136125) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYB5R3 (NADH-cytochrome b5 Reductase 3, B5R, Cytochrome b5 Reductase, Diaphorase-1, DIA1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYB5R3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Sandwich ELISA: The detection limit is 1ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYB5R3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYB5R3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.