Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.16kD).)

Mouse anti-Human CXCR5 Monoclonal Antibody | anti-CXCR5 antibody

CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) APC

Gene Names
CXCR5; BLR1; CD185; MDR15
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CXCR5; Monoclonal Antibody; CXCR5 (C-X-C Chemokine Receptor Type 5; CXC-R5; CXCR-5; Burkitt Lymphoma Receptor 1; Monocyte-derived Receptor 15; MDR-15; CD185; BLR1; MDR15) APC; anti-CXCR5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C1
Specificity
Recognizes human BLR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CXCR5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-56 from human BLR1 (NP_001707) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.16kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.16kD).)

Testing Data

(Detection limit for recombinant GST tagged BLR1 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged BLR1 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-CXCR5 antibody
Chemokines play an important role in inflammation and critical for the recruitment of effector immune cells to sites of infection. Chemokines activate leukocytes by binding to G protein coupled receptors. The ever-growing chemokine receptor subtypes can be divided into 2 major groups, CXCR and CCR, based on the 2 major classes of chemokines. CXCR5 is one of the CXCR receptors, which is expressed in a variety of cells.
Product Categories/Family for anti-CXCR5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
643
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,676 Da
NCBI Official Full Name
C-X-C chemokine receptor type 5 isoform 1
NCBI Official Synonym Full Names
chemokine (C-X-C motif) receptor 5
NCBI Official Symbol
CXCR5
NCBI Official Synonym Symbols
BLR1; CD185; MDR15
NCBI Protein Information
C-X-C chemokine receptor type 5; Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5); Burkitt lymphoma receptor 1, GTP-binding protein; CXC-R5; CXCR-5; MDR-15; monocyte-derived receptor 15
UniProt Protein Name
C-X-C chemokine receptor type 5
Protein Family
UniProt Gene Name
CXCR5
UniProt Synonym Gene Names
BLR1; MDR15; CXC-R5; CXCR-5; MDR-15
UniProt Entry Name
CXCR5_HUMAN

Uniprot Description

CXCR5: Cytokine receptor that binds to B-lymphocyte chemoattractant (BLC). Involved in B-cell migration into B-cell follicles of spleen and Peyer patches but not into those of mesenteric or peripheral lymph nodes. May have a regulatory function in Burkitt lymphoma (BL) lymphomagenesis and/or B-cell differentiation. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; C-X-C chemokine receptor activity

Biological Process: positive regulation of cytokinesis; G-protein coupled receptor protein signaling pathway; B cell activation; immune response; cell motility; chemotaxis; lymph node development

Similar Products

Product Notes

The CXCR5 cxcr5 (Catalog #AAA6136123) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CXCR5 (C-X-C Chemokine Receptor Type 5, CXC-R5, CXCR-5, Burkitt Lymphoma Receptor 1, Monocyte-derived Receptor 15, MDR-15, CD185, BLR1, MDR15) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCR5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCR5 cxcr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCR5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.