Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (29.7kD).)

Mouse anti-Human CX3CR1 Monoclonal Antibody | anti-CX3CR1 antibody

CX3CR1 (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) APC

Gene Names
CX3CR1; V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CX3CR1; Monoclonal Antibody; CX3CR1 (Beta Chemokine Receptor-like 1; CCRL1; Chemokine C-X3-C Motif Receptor 1; CX3C Chemokine Receptor 1; C-X3-C CKR-1; CX3C CKR-1; CMK-BRL-1; CMKBLR1; CMKDR1; Fractalkine Receptor; GPR13; GPRV28; V28) APC; anti-CX3CR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B11
Specificity
Recognizes human CX3CR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CX3CR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-36 from human CX3CR1 (AAH28078) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (29.7kD).)

Western Blot (WB) (Western Blot detection against immunogen (29.7kD).)

Testing Data

(Detection limit for 125493 is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for 125493 is ~10ng/ml as a capture antibody.)
Related Product Information for anti-CX3CR1 antibody
Human CX3CR1 has been shown to mediate both the adhesive and migratory functions of fractalkine. Fractalkine and CX 3 CR1 represent new types of leukocyte trafficking regulators.
Product Categories/Family for anti-CX3CR1 antibody
References
1. The involvement of the fractalkine receptor in the transmigration of neuroblastoma cells through bone-marrow endothelial cells. Nevo I, Sagi-Assif O, Meshel T, Ben-Baruch A, Johrer K, Greil R, Trejo LE, Kharenko O, Feinmesser M, Yron I, Witz IP.Cancer Lett. 2009 Jan 8;273(1):127-39. Epub 2008 Sep 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43,969 Da
NCBI Official Full Name
Homo sapiens chemokine (C-X3-C motif) receptor 1, mRNA
NCBI Official Synonym Full Names
C-X3-C motif chemokine receptor 1
NCBI Official Symbol
CX3CR1
NCBI Official Synonym Symbols
V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
NCBI Protein Information
CX3C chemokine receptor 1
Protein Family

NCBI Description

Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Research Articles on CX3CR1

Similar Products

Product Notes

The CX3CR1 (Catalog #AAA6136115) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CX3CR1 (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CX3CR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CX3CR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CX3CR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.