Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse anti-Human CX3CL1 Monoclonal Antibody | anti-CX3CL1 antibody
CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2) (PE)
Gene Names
CX3CL1; NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CX3CL1; Monoclonal Antibody; CX3CL1 (Fractalkine; C-X3-C Motif Chemokine 1; CX3C Membrane-anchored Chemokine; Neurotactin; Small-inducible Cytokine D1; FKN; NTT; SCYD1; A-152E5.2) (PE); anti-CX3CL1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D6
Specificity
Recognizes human CX3CL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CX3CL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa26-136 from human CX3CL1 (AAH01163) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Testing Data
(Detection limit for recombinant GST tagged CX3CL1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged CX3CL1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CX3CL1 antibody
Fractalkine, also known as neurotactin, is a membrane-bound CX3C Chemokine. The mature protein is part of a 397aa precursor and consists of a chemokine domain of 76aa, a mucin stalk of 241aa, a putative transmembrane domain of 18aa, and an intracellular tail of 37aa. Within the chemokine domain, the first two cysteine residues are separated by 3aa (CX3C). Fractalkine message is found in high abundance in the brain, kidney, lung and heart tissues. Fractalkine is chemotactic for monocytes and other leukocytes including NK cells and may play a role in brain inflammation.
Product Categories/Family for anti-CX3CL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
42,203 Da
NCBI Official Full Name
Homo sapiens chemokine (C-X3-C motif) ligand 1, mRNA
NCBI Official Synonym Full Names
C-X3-C motif chemokine ligand 1
NCBI Official Symbol
CX3CL1
NCBI Official Synonym Symbols
NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
NCBI Protein Information
fractalkine
Protein Family
Research Articles on CX3CL1
Similar Products
Product Notes
The CX3CL1 (Catalog #AAA6157326) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CX3CL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CX3CL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CX3CL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
