Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human CTTN Monoclonal Antibody | anti-CTTN antibody

CTTN (Src Substrate Cortactin,, Amplaxin, Oncogene EMS1, FLJ34459) (Biotin)

Gene Names
CTTN; EMS1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTTN; Monoclonal Antibody; CTTN (Src Substrate Cortactin; ; Amplaxin; Oncogene EMS1; FLJ34459) (Biotin); anti-CTTN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human CTTN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CTTN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa341-450 from human CTTN (NP_005222.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged CTTN is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CTTN is 0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between SYK and CTTN. HeLa cells were stained with SYK rabbit purified polyclonal 1:1200 and CTTN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between SYK and CTTN. HeLa cells were stained with SYK rabbit purified polyclonal 1:1200 and CTTN mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CTTN antibody
Contributes to the organization of the actin cytoskeleton and cell structure. Plays a role in the regulation of cell migration. Plays a role in the invasiveness of cancer cells, and the formation of metastases.
Product Categories/Family for anti-CTTN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,467 Da
NCBI Official Full Name
src substrate cortactin isoform a
NCBI Official Synonym Full Names
cortactin
NCBI Official Symbol
CTTN
NCBI Official Synonym Symbols
EMS1
NCBI Protein Information
src substrate cortactin; amplaxin; 1110020L01Rik; oncogene EMS1; ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate)
UniProt Protein Name
Src substrate cortactin
UniProt Gene Name
CTTN
UniProt Synonym Gene Names
EMS1
UniProt Entry Name
SRC8_HUMAN

NCBI Description

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. [provided by RefSeq, May 2010]

Uniprot Description

Cortactin: a cytoskeletal protein that that is involved in coordinating actin reorganization during cell movement. Localizes at the leading edge of lamellipodia during cell migration. Its amino-terminal acidic domain associates with the Arp2/3 and WASP complex at F-actin branches. The central region of the protein contains six repeats of 37 amino acids that are important in F-actin binding and cross-linking. The carboxy-terminus contains a proline-rich region and an SH3 domain that can interact with numerous scaffolding proteins, such as CortBP1 and Shank3. Cortactin may play a role in the organization of transmembrane receptors at postsynaptic densities (PSD) and tight junctions by linking scaffolding proteins to the actin network. It is degraded in a caspase-dependent manner during apoptosis. It is overexpressed in numerous cancers with poor patient prognosis. It may contribute to tumor cell invasion and metastasis. Two splice variant isoforms have been identified.

Protein type: Motility/polarity/chemotaxis; Actin-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: cortical cytoskeleton; voltage-gated potassium channel complex; focal adhesion; dendritic spine; actin filament; coated pit; cell cortex; ruffle; growth cone; cytoskeleton; lamellipodium; cytoplasm; podosome

Molecular Function: protein binding

Biological Process: focal adhesion formation; intracellular protein transport; receptor-mediated endocytosis; positive regulation of actin filament polymerization; actin filament polymerization; actin cytoskeleton reorganization; cell motility involved in cell locomotion; regulation of axon extension; substrate-bound cell migration, cell extension; neurite morphogenesis

Research Articles on CTTN

Similar Products

Product Notes

The CTTN cttn (Catalog #AAA6141412) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTTN (Src Substrate Cortactin,, Amplaxin, Oncogene EMS1, FLJ34459) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTTN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTTN cttn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTTN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.