Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CTNNBIP1 Monoclonal Antibody | anti-CTNNBIP1 antibody

CTNNBIP1 (Beta-catenin-interacting Protein 1, Inhibitor of beta-catenin and Tcf-4, ICAT, MGC15093) (MaxLight 750)

Gene Names
CTNNBIP1; ICAT
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTNNBIP1; Monoclonal Antibody; CTNNBIP1 (Beta-catenin-interacting Protein 1; Inhibitor of beta-catenin and Tcf-4; ICAT; MGC15093) (MaxLight 750); anti-CTNNBIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5C6
Specificity
Recognizes human CTNNBIP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-CTNNBIP1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-82 from human CTNNBIP1 (NP_064633) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CTNNBIP1 antibody
Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway.
Product Categories/Family for anti-CTNNBIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.3kDa (101a) confirmed by MALDI-TOF
NCBI Official Full Name
beta-catenin-interacting protein 1
NCBI Official Synonym Full Names
catenin beta interacting protein 1
NCBI Official Symbol
CTNNBIP1
NCBI Official Synonym Symbols
ICAT
NCBI Protein Information
beta-catenin-interacting protein 1
UniProt Protein Name
Beta-catenin-interacting protein 1
UniProt Gene Name
CTNNBIP1
UniProt Synonym Gene Names
ICAT
UniProt Entry Name
CNBP1_HUMAN

NCBI Description

The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CTNNBIP1: Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway. Belongs to the CTNNBIP1 family.

Protein type: Cell development/differentiation; Inhibitor

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: nucleoplasm; cytoplasm; nucleus; beta-catenin destruction complex; cytosol

Molecular Function: protein binding; beta-catenin binding

Biological Process: anterior/posterior pattern formation; positive regulation of monocyte differentiation; positive regulation of osteoblast differentiation; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; ureteric bud branching; negative regulation of smooth muscle cell proliferation; negative regulation of transcription factor activity; negative regulation of protein binding; regulation of vascular permeability during acute inflammatory response; negative regulation of DNA binding

Research Articles on CTNNBIP1

Similar Products

Product Notes

The CTNNBIP1 ctnnbip1 (Catalog #AAA6232362) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTNNBIP1 (Beta-catenin-interacting Protein 1, Inhibitor of beta-catenin and Tcf-4, ICAT, MGC15093) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTNNBIP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTNNBIP1 ctnnbip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTNNBIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.