Mouse CTNNBIP1 Monoclonal Antibody | anti-CTNNBIP1 antibody

CTNNBIP1 (Catenin, beta Interacting Protein 1, ICAT, MGC15093) (Biotin)

Cat. Num. AAA6173988

• Gene Names: CTNNBIP1; ICAT
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: CTNNBIP1; Monoclonal Antibody; CTNNBIP1 (Catenin; beta Interacting Protein 1; ICAT; MGC15093) (Biotin); Catenin; MGC15093; anti-CTNNBIP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B3
• Specificity: Recognizes human CTNNBIP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CTNNBIP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa1-81 from human CTNNBIP1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CTNNBIP1 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-CTNNBIP1 antibody

The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-CTNNBIP1 antibody

Antibodies; Catenin

NCBI and Uniprot Product Information

• NCBI GI #: 9910390
• NCBI GeneID: 56998
• NCBI Accession #: NP_064633
• NCBI GenBank Nucleotide #: NM_020248.2
• UniProt Accession #: Q9NSA3; Q5T4V2
• Molecular Weight: 11.3kDa (101a) confirmed by MALDI-TOF
• NCBI Official Full Name: beta-catenin-interacting protein 1
• NCBI Official Synonym Full Names: catenin beta interacting protein 1
• NCBI Official Symbol: CTNNBIP1
• NCBI Official Synonym Symbols: ICAT
• NCBI Protein Information: beta-catenin-interacting protein 1
• UniProt Protein Name: Beta-catenin-interacting protein 1
• Protein Family: Beta-catenin-interacting protein
• UniProt Gene Name: CTNNBIP1
• UniProt Synonym Gene Names: ICAT
• UniProt Entry Name: CNBP1_HUMAN

NCBI Description

The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CTNNBIP1: Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway. Belongs to the CTNNBIP1 family.

Protein type: Cell development/differentiation; Inhibitor

Chromosomal Location of Human Ortholog: 1p36.22

Cellular Component: nucleoplasm; cytoplasm; nucleus; beta-catenin destruction complex; cytosol

Molecular Function: protein binding; beta-catenin binding

Biological Process: anterior/posterior pattern formation; positive regulation of monocyte differentiation; positive regulation of osteoblast differentiation; Wnt receptor signaling pathway; negative regulation of Wnt receptor signaling pathway; ureteric bud branching; negative regulation of smooth muscle cell proliferation; negative regulation of transcription factor activity; negative regulation of protein binding; regulation of vascular permeability during acute inflammatory response; negative regulation of DNA binding