Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CTNA1 Monoclonal Antibody | anti-CTNA1 antibody

CTNA1 (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1) (FITC)

Gene Names
CTNNA1; CAP102
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTNA1; Monoclonal Antibody; CTNA1 (Catenin alpha-1; Cadherin-associated Protein; Alpha E-catenin; Renal Carcinoma Antigen NY-REN-13; CTNNA1) (FITC); anti-CTNA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G6
Specificity
Recognizes human CTNNA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CTNA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa152-250 from human CTNNA1 (NP_001894) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged CTNNA1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CTNNA1 is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between ARRB2 and CTNNA1. HeLa cells were stained with ARRB2 rabbit purified polyclonal 1:1200 and CTNNA1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between ARRB2 and CTNNA1. HeLa cells were stained with ARRB2 rabbit purified polyclonal 1:1200 and CTNNA1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CTNA1 antibody
CTNA1 associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. The protein may play a crucial role in cell differentiation.
Product Categories/Family for anti-CTNA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,550 Da
NCBI Official Full Name
catenin alpha-1 isoform 1
NCBI Official Synonym Full Names
catenin (cadherin-associated protein), alpha 1, 102kDa
NCBI Official Symbol
CTNNA1
NCBI Official Synonym Symbols
CAP102
NCBI Protein Information
catenin alpha-1; alpha E-catenin; alpha-E-catenin; alpha-catenin; alphaE-catenin; cadherin-associated protein,102kDa; renal carcinoma antigen NY-REN-13
UniProt Protein Name
Catenin alpha-1
UniProt Gene Name
CTNNA1
UniProt Entry Name
CTNA1_HUMAN

Uniprot Description

CTNNA1: Associates with the cytoplasmic domain of a variety of cadherins. The association of catenins to cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Can associate with both E- and N-cadherins. Originally believed to be a stable component of E-cadherin/catenin adhesion complexes and to mediate the linkage of cadherins to the actin cytoskeleton at adherens junctions. In contrast, cortical actin was found to be much more dynamic than E-cadherin/catenin complexes and CTNNA1 was shown not to bind to F-actin when assembled in the complex suggesting a different linkage between actin and adherens junctions components. The homodimeric form may regulate actin filament assembly and inhibit actin branching by competing with the Arp2/3 complex for binding to actin filaments. May play a crucial role in cell differentiation. Monomer and homodimer; the monomer preferentially binds to CTNNB1 and the homodimer to actin. Binds MLLT4 and F-actin. Possible component of an E-cadherin/ catenin adhesion complex together with E-cadherin/CDH1 and beta-catenin/CTNNB1 or gamma- catenin/JUP; the complex is located to adherens junctions. The stable association of CTNNA1 is controversial as CTNNA1 was shown not to bind to F-actin when assembled in the complex. Alternatively, the CTNNA1-containing complex may be linked to F- actin by other proteins such as LIMA1. Interacts with ARHGAP21 and with AJUBA. Interacts with LIMA1. Expressed ubiquitously in normal tissues. Belongs to the vinculin/alpha-catenin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: focal adhesion; lamellipodium; acrosome; plasma membrane; intercellular junction; zonula adherens; catenin complex; cytosol; actin cytoskeleton

Molecular Function: actin filament binding; protein binding; cadherin binding; gamma-catenin binding; beta-catenin binding; structural molecule activity; vinculin binding

Biological Process: intercellular junction assembly and maintenance; apical junction assembly; gap junction assembly; protein heterooligomerization; axon regeneration; male gonad development; establishment and/or maintenance of cell polarity; actin filament organization; odontogenesis of dentine-containing teeth; muscle cell differentiation; ovarian follicle development; negative regulation of neuroblast proliferation; response to estrogen stimulus; positive regulation of muscle cell differentiation; positive regulation of smoothened signaling pathway; cell adhesion; vascular endothelial growth factor receptor signaling pathway; aging

Similar Products

Product Notes

The CTNA1 ctnna1 (Catalog #AAA6146704) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTNA1 (Catenin alpha-1, Cadherin-associated Protein, Alpha E-catenin, Renal Carcinoma Antigen NY-REN-13, CTNNA1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTNA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTNA1 ctnna1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTNA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.