Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using MBS6007563.)

Mouse anti-Human CTAG2 Monoclonal Antibody | anti-CTAG2 antibody

CTAG2 (ESO2, LAGE1, Cancer/Testis Antigen 2, CT2, Autoimmunogenic Cancer/Testis Antigen NY-ESO-2, Cancer/Testis Antigen 6.2, CT6.2, L Antigen Family Member 1, LAGE-1, MGC138724, MGC3803) (MaxLight 405)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTAG2; Monoclonal Antibody; CTAG2 (ESO2; LAGE1; Cancer/Testis Antigen 2; CT2; Autoimmunogenic Cancer/Testis Antigen NY-ESO-2; Cancer/Testis Antigen 6.2; CT6.2; L Antigen Family Member 1; LAGE-1; MGC138724; MGC3803) (MaxLight 405); anti-CTAG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H1
Specificity
Recognizes human CTAG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
210
Applicable Applications for anti-CTAG2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa111-210 from human CTAG2 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD) using MBS6007563.)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using MBS6007563.)

Testing Data

(Detection limit is ~0.1ng/ml using MBS6007563 as a capture antibody.)

Testing Data (Detection limit is ~0.1ng/ml using MBS6007563 as a capture antibody.)
Related Product Information for anti-CTAG2 antibody
This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID 10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq].
Product Categories/Family for anti-CTAG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cancer/testis antigen 2 isoform LAGE-1b
UniProt Protein Name
Cancer/testis antigen 2
Protein Family
UniProt Gene Name
CTAG2
UniProt Synonym Gene Names
ESO2; LAGE1; CT2; CT6.2; LAGE-1
UniProt Entry Name
CTAG2_HUMAN

Similar Products

Product Notes

The CTAG2 ctag2 (Catalog #AAA6189649) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CTAG2 (ESO2, LAGE1, Cancer/Testis Antigen 2, CT2, Autoimmunogenic Cancer/Testis Antigen NY-ESO-2, Cancer/Testis Antigen 6.2, CT6.2, L Antigen Family Member 1, LAGE-1, MGC138724, MGC3803) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTAG2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTAG2 ctag2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTAG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.