Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD),.)

Mouse anti-Human CSNK2A2 Monoclonal Antibody | anti-CSNK2A2 antibody

CSNK2A2 (Casein Kinase II Subunit alpha', CK II alpha', CK2A2) (HRP)

Gene Names
CSNK2A2; CK2A2; CSNK2A1; CK2alpha'
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CSNK2A2; Monoclonal Antibody; CSNK2A2 (Casein Kinase II Subunit alpha'; CK II alpha'; CK2A2) (HRP); anti-CSNK2A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E8
Specificity
Recognizes human CSNK2A2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CSNK2A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CSNK2A2 (NP_001887.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLID
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD),.)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD),.)

Testing Data

(Detection limit for recombinant GST tagged CSNK2A2 is ~0.3ng/ml as a capture antibody,.)

Testing Data (Detection limit for recombinant GST tagged CSNK2A2 is ~0.3ng/ml as a capture antibody,.)
Related Product Information for anti-CSNK2A2 antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The AGC kinase group consists of 63 kinases including the cyclic nucleotide-regulated protein kinase (PKA & PKG) family, the diacylglycerol-activated/ phospholipid-dependent protein kinase C (PKC) family, the related to PKA and PKC (RAC/Akt) protein kinase family, the kinases that phosphorylate G protein-coupled receptors family (ARK), and the kinases that phosphorylate ribosomal protein S6 family (RSK).
Product Categories/Family for anti-CSNK2A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
casein kinase II subunit alpha'
NCBI Official Synonym Full Names
casein kinase 2 alpha 2
NCBI Official Symbol
CSNK2A2
NCBI Official Synonym Symbols
CK2A2; CSNK2A1; CK2alpha'
NCBI Protein Information
casein kinase II subunit alpha'
UniProt Protein Name
Casein kinase II subunit alpha'
Protein Family
UniProt Gene Name
CSNK2A2
UniProt Synonym Gene Names
CK2A2; CK II alpha'
UniProt Entry Name
CSK22_HUMAN

Uniprot Description

CK2A2: Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.

Protein type: Kinase, protein; EC 2.7.11.1; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Other group; CK2 family

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: PcG protein complex; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; protein N-terminus binding; ATP binding

Biological Process: axon guidance; Wnt receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; apoptosis; mitotic cell cycle; protein amino acid phosphorylation

Research Articles on CSNK2A2

Similar Products

Product Notes

The CSNK2A2 csnk2a2 (Catalog #AAA6151990) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSNK2A2 (Casein Kinase II Subunit alpha', CK II alpha', CK2A2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK2A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSNK2A2 csnk2a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK2A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.