Rabbit anti-Human CSNK2A2 Polyclonal Antibody | anti-CSNK2A2 antibody

CSNK2A2 (Casein Kinase II Subunit alpha', CK II alpha', CK2A2) (HRP)

Cat. Num. AAA6374922

• Gene Names: CSNK2A2; CK2A2; CSNK2A1; CK2alpha'
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CSNK2A2; Polyclonal Antibody; CSNK2A2 (Casein Kinase II Subunit alpha'; CK II alpha'; CK2A2) (HRP); anti-CSNK2A2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CSNK2A2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-CSNK2A2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CSNK2A2, aa1-350 (NP_001887.1).
• Immunogen Sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CSNK2A2 expression in transfected 293T cell line by CSNK2A2 polyclonal antibody. Lane 1: CSNK2A2 transfected lysate (41.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CSNK2A2 antibody

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains. The AGC kinase group consists of 63 kinases including the cyclic nucleotide-regulated protein kinase (PKA & PKG) family, the diacylglycerol-activated/phospholipid-dependent protein kinase C (PKC) family, the related to PKA and PKC (RAC/Akt) protein kinase family, the kinases that phosphorylate G protein-coupled receptors family (ARK), and the kinases that phosphorylate ribosomal protein S6 family (RSK).

Product Categories/Family for anti-CSNK2A2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4503097
• NCBI GeneID: 1459
• NCBI Accession #: NP_001887.1
• NCBI GenBank Nucleotide #: NM_001896.2
• UniProt Accession #: P19784
• Molecular Weight: 41kDa
• NCBI Official Full Name: casein kinase II subunit alpha'
• NCBI Official Synonym Full Names: casein kinase 2 alpha 2
• NCBI Official Symbol: CSNK2A2
• NCBI Official Synonym Symbols: CK2A2; CSNK2A1; CK2alpha'
• NCBI Protein Information: casein kinase II subunit alpha'
• UniProt Protein Name: Casein kinase II subunit alpha'
• Protein Family: Casein kinase
• UniProt Gene Name: CSNK2A2
• UniProt Synonym Gene Names: CK2A2; CK II alpha'
• UniProt Entry Name: CSK22_HUMAN

Uniprot Description

CK2A2: Catalytic subunit of a constitutively active serine/threonine-protein kinase complex that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine. Regulates numerous cellular processes, such as cell cycle progression, apoptosis and transcription, as well as viral infection. May act as a regulatory node which integrates and coordinates numerous signals leading to an appropriate cellular response. During mitosis, functions as a component of the p53/TP53-dependent spindle assembly checkpoint (SAC) that maintains cyclin-B-CDK1 activity and G2 arrest in response to spindle damage. Also required for p53/TP53-mediated apoptosis, phosphorylating 'Ser-392' of p53/TP53 following UV irradiation. Can also negatively regulate apoptosis. Phosphorylates the caspases CASP9 and CASP2 and the apoptotic regulator NOL3. Phosphorylation protects CASP9 from cleavage and activation by CASP8, and inhibits the dimerization of CASP2 and activation of CASP8. Regulates transcription by direct phosphorylation of RNA polymerases I, II, III and IV. Also phosphorylates and regulates numerous transcription factors including NF-kappa-B, STAT1, CREB1, IRF1, IRF2, ATF1, SRF, MAX, JUN, FOS, MYC and MYB. Phosphorylates Hsp90 and its co-chaperones FKBP4 and CDC37, which is essential for chaperone function. Regulates Wnt signaling by phosphorylating CTNNB1 and the transcription factor LEF1. Acts as an ectokinase that phosphorylates several extracellular proteins. During viral infection, phosphorylates various proteins involved in the viral life cycles of EBV, HSV, HBV, HCV, HIV, CMV and HPV. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.

Protein type: Kinase, protein; EC 2.7.11.1; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Other group; CK2 family

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: PcG protein complex; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; protein N-terminus binding; ATP binding

Biological Process: axon guidance; Wnt receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; apoptosis; mitotic cell cycle; protein amino acid phosphorylation