Mouse anti-Human CSK Monoclonal Antibody | anti-CSK antibody

CSK (Tyrosine-protein Kinase CSK, C-SRC Kinase, Protein-tyrosine Kinase CYL) (HRP)

Cat. Num. AAA6151984

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CSK; Monoclonal Antibody; CSK (Tyrosine-protein Kinase CSK; C-SRC Kinase; Protein-tyrosine Kinase CYL) (HRP); anti-CSK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A3
• Specificity: Recognizes human CSK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CSK antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human CSK (NP_004374) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of CSK transfected lysate using CSK monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CSK rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CSK is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody. Lane 1: CSK transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(CSK monoclonal antibody. Western Blot analysis of CSK expression in Hela NE.)

Product Categories/Family for anti-CSK antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4758078
• NCBI GeneID: 1445
• NCBI Accession #: NP_004374
• NCBI GenBank Nucleotide #: NM_004383
• UniProt Accession #: P41240
• Molecular Weight: 51kDa
• NCBI Official Full Name: tyrosine-protein kinase CSK
• NCBI Official Synonym Full Names: C-terminal Src kinase
• NCBI Official Symbol: CSK
• NCBI Protein Information: tyrosine-protein kinase CSK
• UniProt Protein Name: Tyrosine-protein kinase CSK
• Protein Family: Chloroplast sensor kinase
• UniProt Gene Name: CSK
• UniProt Entry Name: CSK_HUMAN

NCBI Description

The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017]

Uniprot Description

CSK: a tyrosine kinase of the Csk family that phosphorylates and inhibits Src family kinases. Specifically phosphorylates Y504 on LCK, which acts as a negative regulatory site. Csk and the phospho-tyrosine phosphatase CD45 reciprocally regulate phosphorylation of the inhibitory tyrosine of the Src family kinases Lck and Fyn during T-cell receptor mediated signaling during thymic development.

Protein type: Protein kinase, TK; EC 2.7.10.2; Kinase, protein; Protein kinase, tyrosine (non-receptor); TK group; Csk family

Chromosomal Location of Human Ortholog: 15q24.1

Cellular Component: extrinsic to internal side of plasma membrane; cytoplasm; plasma membrane; intercellular junction; cytosol; lipid raft

Molecular Function: protein C-terminus binding; identical protein binding; protein binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; protein phosphatase binding; ATP binding; receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; platelet activation; negative regulation of kinase activity; negative regulation of phagocytosis; cell migration; central nervous system development; negative regulation of Golgi to plasma membrane protein transport; protein amino acid phosphorylation; T cell receptor signaling pathway; regulation of cytokine production; regulation of cell proliferation; positive regulation of MAP kinase activity; negative regulation of cell proliferation; T cell costimulation; negative regulation of interleukin-6 production; innate immune response; oligodendrocyte differentiation; morphogenesis of an epithelium; brain development; negative regulation of bone resorption; cell differentiation; blood coagulation; transmembrane receptor protein tyrosine kinase signaling pathway